LOADING...
   TM0236;TM0236
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0236    TM0236            JCSG 360347 Refining 06-JUN-28

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0236
DESCRIPTIONUDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate--D- alanyl-D-alanyl ligase.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WY78_THEMA
DR SPTR; Q9WY78 (flat text); Q9WY78 (good view)
DR GenBank; AAD35327
DR Pfam; PF08245; Mur_ligase_M;
DR Pfam; PF02875; Mur_ligase_C;
DR Pfam; PF01225; Mur_ligase;
DR Interpro; IPR005863; MurF;
DR Interpro; IPR000713; Mur_ligase;
DR Interpro; IPR004101; Mur_ligase_C;
DR PDB; 3ZL8; Identical; 11-SEP-13; UDP-N-ACETYLMURAMOYL-TRIPEPTIDE--D-ALANYL-D-ALANI LIGASE;
DR PDB; 3ZM5; Highly similar; 03-JUL-13; UDP-N-ACETYLMURAMOYL-TRIPEPTIDE--D-ALANYL-D-ALANI LIGASE;
DR PDB; 3ZM6; Highly similar; 03-JUL-13; UDP-N-ACETYLMURAMOYL-TRIPEPTIDE--D-ALANYL-D-ALANI LIGASE;
DR PDB; 2AM1; Highly similar; 24-JAN-06; UDP-N-ACETYLMURAMOYLALANINE-D-GLUTAMYL-LYSINE-D- ALANYL-D-AL;
DR PDB; 2AM2; Highly similar; 24-JAN-06; UDP-N-ACETYLMURAMOYLALANINE-D-GLUTAMYL-LYSINE-D- ALANYL-D-AL;
DR PDB; 4QDI; Highly similar; 01-APR-15; UDP-N-ACETYLMURAMOYL-TRIPEPTIDE--D-ALANYL-D-ALANI CHAIN: A;
DR PDB; 4QF5; Highly similar; 01-APR-15; UDP-N-ACETYLMURAMOYL-TRIPEPTIDE--D-ALANYL-D-ALANI CHAIN: A,;
DR FFAS; 282115; Fold and function assignment.
DR TVPC; TM0236; Homologs in PDB, JCSG and SG center.
DR OVP; TM0236; Ortholog view popup.
DR TPM; TM0236; Target PDB monitor.
DR FSS; TM0236; Target function coverage.
PROPERTY Residues: 426 aa
Molecule Weight: 47894.59 Dalton
Isoelectric Point: 7
Extinction Coefficient: 36900
Gravy Index: -.23
Number of Met residues: 8
Percentage of Met residues: 1.88 %
Number of Cys residues: 2
Percentage of Cys residues: 0.47 %
SEQUENCE  amino acids 426 aa
>TM0236  TM0236 UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanyl ligase (murF)
MKDLLTRRFVLNSKEVREGDVFVAVKGKRFDGHDFIDEALRNGAYAIIAERKTVNSDRIF
LVESSVDTLAKLAREKLGNFSGTVVGVTGSSGKTTTKEILYNLLKNKRSVFKTPGNMNTE
YGLPLSILNDYKGEEILVLEMAASRPGDIAHLCKIAPPDVAVLLNVGSAHLEFFGTRERI
METKMEIIKHSKENAIAVTLFDDPDLRKEVPRYRNTLFFGKEGGDSVLKDWWYYEGSTIA
EFEAFDSLFTVKLSGYWNGGQLLNIAASLCVMRTLGETVDIFDLASLKTVPGRFNVREKK
GVLIVDDTYNASPEAFQTSIEALLRFPGKKFAVVGAMKELGERSKEFHEELGERLNVLDG
VYVFLSEPEAEWIKSKKIILKSDDPEKIAKDLATRVKKGDVVLFKASRAVRIERVLEMFE
KELEKR

CDS  cDNA 1278 bp
   1 atgaaagatc tactcacaag gcgtttcgtt ctgaattcga aagaagtgag agaaggtgac    60
  61 gtgttcgtcg ccgtgaaagg gaaaagattc gatggtcacg attttataga tgaagccctc   120
 121 aggaacggcg cttatgcgat cattgccgag agaaaaacgg tgaattctga tagaatcttt   180
 181 ctcgtagaaa gttccgttga cacgcttgct aagctggccc gagaaaagct cgggaatttt   240
 241 tccggtacag tcgttggtgt aacaggttca tcgggaaaaa ccaccacgaa agaaatattg   300
 301 tacaaccttc tcaaaaacaa gagaagtgtc ttcaaaacac cgggaaacat gaacacggag   360
 361 tacgggttgc cactctccat tctcaacgac tacaaaggag aagaaatcct ggttctcgaa   420
 421 atggccgcga gcaggcccgg tgatatcgct cacctgtgta aaatcgctcc tccggatgtc   480
 481 gccgttctcc tcaacgttgg aagcgctcac ctcgagtttt ttggaacacg agaaagaatc   540
 541 atggaaacca agatggagat catcaagcac tcgaaagaaa atgcgatagc cgtaacactc   600
 601 tttgacgatc ctgatctgag aaaagaagtg cctcgctaca gaaatacact gttcttcggc   660
 661 aaagaaggcg gtgactcggt tctaaaggat tggtggtact atgagggttc cacgatcgca   720
 721 gagttcgaag cttttgattc tcttttcaca gtgaaactct ccggatactg gaatggaggg   780
 781 caacttctga acatcgccgc ttctctgtgt gtcatgagaa ctttgggcga aactgtggat   840
 841 atcttcgatc ttgccagcct gaaaacagtt cccggccgtt tcaacgtgag agaaaaaaaa   900
 901 ggtgtgctga tcgtggatga tacgtacaac gcaagccctg aagcgtttca aacttccata   960
 961 gaggcgcttc ttcgtttccc cggaaagaaa ttcgctgttg tgggagcgat gaaagagctc  1020
1021 ggggagaggt cgaaggagtt tcacgaagaa ctgggagaga gattgaacgt tctggatggg  1080
1081 gtgtatgttt tcttgtcaga acccgaagca gaatggatca agtccaaaaa gatcatcctg  1140
1141 aagtcagacg atcccgaaaa gatagcgaaa gatctcgcca ccagggtaaa aaaaggggat  1200
1201 gtggttctct tcaaagcttc aagagcggtg agaatagaaa gagttctgga aatgtttgaa  1260
1261 aaggagctgg agaaaaga  1278
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
250621 251901 -1 Glimmer3 score 13.53 good
Genemark probabilities .93   .93 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu