LOADING...
   TM0231;TM0231
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0231    TM0231            JCSG 282110 PDB Deposition 02-AUG-29              PDB id: 1j6u

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0231
DESCRIPTIONUDP-N-acetylmuramate--L-alanine ligase MurC (EC 6.3.2.8) (UDP-N- acetylmuramoyl-L-alanine synthetase).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: CELL WALL FORMATION.
-!- CATALYTIC ACTIVITY: ATP + UDP-N-ACETYLMURAMOYL + L-ALANINE = ADP +
PHOSPHATE + UDP-N-ACETYLMURAMOYL-L-ALANINE.
-!- PATHWAY: PEPTIDOGLYCAN BIOSYNTHESIS.
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (PROBABLE).
-!- SIMILARITY: BELONGS TO THE MURCDEF FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; MURC_THEMA
DR SPTR; Q9WY73 (flat text); Q9WY73 (good view)
DR GenBank; AAD35322
DR Pfam; PF01225; Mur_ligase;
DR Pfam; PF02875; Mur_ligase_C;
DR Pfam; PF08245; Mur_ligase_M;
DR Interpro; IPR000713; Mur_ligase;
DR Interpro; IPR004101; Mur_ligase_C;
DR Interpro; IPR005758; MurC;
DR PDB; 1J6U; Identical; 06-NOV-02; UDP-N-ACETYLMURAMATE-ALANINE LIGASE MURC;
DR PDB; 1GQY; Highly similar; 13-JUN-03; UDP-N-ACETYLMURAMATE-L-ALANINE LIGASE;
DR PDB; 1GQQ; Highly similar; 15-JUN-03; UDP-N-ACETYLMURAMATE-L-ALANINE LIGASE;
DR PDB; 1P31; Highly similar; 15-JUL-03; UDP-N-ACETYLMURAMATE--ALANINE LIGASE;
DR PDB; 1P3D; Highly similar; 15-JUL-03; UDP-N-ACETYLMURAMATE--ALANINE LIGASE;
DR KEGG; 6.3.2.8; Enzyme page
DR FFAS; 282110; Fold and function assignment.
DR TVPC; TM0231; Homologs in PDB, JCSG and SG center.
DR OVP; TM0231; Ortholog view popup.
DR TPM; TM0231; Target PDB monitor.
DR FSS; TM0231; Target function coverage.
PROPERTY Residues: 457 aa
Molecule Weight: 51868.97 Dalton
Isoelectric Point: 5.71
Extinction Coefficient: 39310
Gravy Index: -.39
Number of Met residues: 8
Percentage of Met residues: 1.75 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 457 aa
>TM0231  TM0231 UDP-N-acetylmuramate--alanine ligase (murC)
MKIHFVGIGGIGMSAVALHEFSNGNDVYGSNIEETERTAYLRKLGIPIFVPHSADNWYDP
DLVIKTPAVRDDNPEIVRARMERVPIENRLHYFRDTLKREKKEEFAVTGTDGKTTTTAMV
AHVLKHLRKSPTVFLGGIMDSLEHGNYEKGNGPVVYELDESEEFFSEFSPNYLIITNARG
DHLENYGNSLTRYRSAFEKISRNTDLVVTFAEDELTSHLGDVTFGVKKGTYTLEMRSASR
AEQKAMVEKNGKRYLELKLKVPGFHNVLNALAVIALFDSLGYDLAPVLEALEEFRGVHRR
FSIAFHDPETNIYVIDDYAHTPDEIRNLLQTAKEVFENEKIVVIFQPHRYSRLEREDGNF
AKALQLADEVVVTEVYDAFEEKKNGISGKMIWDSLKSLGKEAYFVEKLPELEKVISVSEN
TVFLFVGAGDIIYSSRRFVERYQSSKSSPSRVLGSNK

CDS  cDNA 1371 bp
   1 gtgaaaattc atttcgtagg aattggtgga attggaatga gtgccgtggc tttacacgaa    60
  61 ttctcgaatg gaaacgatgt ttacggttca aatatagagg aaacagaaag aaccgcttat   120
 121 ctaagaaaat taggaattcc gatttttgtg ccacactccg cagacaactg gtacgatccc   180
 181 gatctggtta taaaaacccc cgctgttcgt gacgacaacc cggagatagt acgcgccagg   240
 241 atggaaaggg tcccgatcga aaacagactg cattatttcc gagacactct gaaacgggag   300
 301 aaaaaggaag agttcgctgt aaccggaacc gatggcaaaa ccacgacaac cgctatggtt   360
 361 gcacacgttt tgaaacattt gagaaagtct ccaacggtgt tccttggagg tataatggat   420
 421 tctctcgaac acggaaacta cgagaaagga aacggacctg tagtttacga actcgacgag   480
 481 agcgaagagt ttttctcaga gttctctcca aactatctca taatcacaaa cgccagagga   540
 541 gatcatctgg aaaactacgg caactccctg accagataca gatcggcctt cgaaaagatc   600
 601 agcaggaaca ccgatctggt agtcaccttc gcagaggacg aactcacatc tcatctcggt   660
 661 gatgtaactt ttggcgtgaa gaaaggcaca tacaccctcg agatgagaag tgcctctcgc   720
 721 gccgagcaaa aagcaatggt ggagaaaaat ggaaagagat atctcgaact caaactcaag   780
 781 gttcccggtt ttcacaacgt tttgaacgca ctggcagtga tagcgctttt cgactcgctc   840
 841 gggtacgatc tggcaccagt gctcgaagcg ctggaagaat tccggggagt tcacaggcgt   900
 901 ttttccatcg cgtttcacga tccggaaacg aacatctatg tgatagacga ctacgcccac   960
 961 acaccagatg agataagaaa ccttcttcag acagcaaaag aagtcttcga aaacgaaaaa  1020
1021 atcgtggtga tattccagcc gcaccgatat tccagactgg aaagagaaga cggaaacttc  1080
1081 gcaaaggcgc ttcagctggc ggatgaagtt gtggtcacgg aagtctacga tgcgttcgaa  1140
1141 gagaagaaaa acggcatctc agggaagatg atctgggact ctctcaagtc gctcggtaaa  1200
1201 gaggcatatt tcgttgagaa gcttccagaa ctggaaaagg taatctccgt gagtgagaac  1260
1261 accgtcttcc ttttcgttgg tgccggagat atcatctact cttccagaag gttcgtggaa  1320
1321 cgttatcaga gctccaaaag ttctccttcg cgcgtcctag gatcgaacaa a  1371
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
244950 246323 -3 Glimmer3 score 11.74 poor
Genemark probabilities .87   .84 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu