LOADING...
   TM0216;TM0216
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0216    TM0216            JCSG 282096 PDB Deposition 02-JUL-05              PDB id: 1j5w

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0216
DESCRIPTIONGlycyl-tRNA synthetase alpha chain (EC 6.1.1.14)
ORGANISMThermotoga maritima
COMMENTSubsystem: tRNA aminoacylation. Very conservative enzyme.
The aminoacyl-tRNA synthetases (EC 6.1.1. ) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction
Supporting genome and functional context: clustering on a chromosome with the enzymes involved into Glycine metabolism ( TM0213 - TM0214 and TM0216 - TM0217 ):
TM0213 - Glycine dehydrogenase [decarboxylating] subunit 1 (EC 1.4.4.2), TM0214 - Glycine dehydrogenase [decarboxylating] subunit 2 (EC 1.4.4.2),
TM0217 - Glycyl-tRNA synthetase beta chain (EC 6.1.1.14).
-----------------------------------------------------------------------------
!- CATALYTIC ACTIVITY: ATP + GLYCINE + TRNA(GLY) = AMP + DIPHOSPHATE
+ GLYCYL-TRNA(GLY).
-!- SUBUNIT: TETRAMER OF TWO ALPHA AND TWO BETA CHAINS (BY
SIMILARITY).
-!- SUBCELLULAR LOCATION: CYTOPLASMIC.
-!- SIMILARITY: BELONGS TO CLASS-II AMINOACYL-TRNA SYNTHETASE FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; SYGA_THEMA
DR SPTR; Q9WY59 (flat text); Q9WY59 (good view)
DR GenBank; AAD35308
DR Pfam; PF02091; tRNA-synt_2e;
DR Interpro; IPR002310; tRNA_synt_2e;
DR Interpro; IPR006194; tRNA_synt_Gly;
DR PDB; 1J5W; Identical; 17-JUL-02; GLYCYL-TRNA SYNTHETASE ALPHA CHAIN;
DR PDB; 3RF1; Highly similar; 20-APR-11; GLYCYL-TRNA SYNTHETASE ALPHA SUBUNIT;
DR PDB; 3RGL; Highly similar; 08-JUN-11; GLYCYL-TRNA SYNTHETASE ALPHA SUBUNIT;
DR PDB; 3UFG; Highly similar; 09-NOV-11; GLYCYL-TRNA SYNTHETASE ALPHA SUBUNIT;
DR KEGG; 6.1.1.14; Enzyme page
DR FFAS; 282096; Fold and function assignment.
DR TVPC; TM0216; Homologs in PDB, JCSG and SG center.
DR OVP; TM0216; Ortholog view popup.
DR TPM; TM0216; Target PDB monitor.
DR FSS; TM0216; Target function coverage.
PROPERTY Residues: 286 aa
Molecule Weight: 33538.3 Dalton
Isoelectric Point: 4.99
Extinction Coefficient: 66810
Gravy Index: -.43
Number of Met residues: 6
Percentage of Met residues: 2.10 %
Number of Cys residues: 2
Percentage of Cys residues: 0.70 %
SEQUENCE  amino acids 286 aa
>TM0216  TM0216 glycyl-tRNA synthetase, alpha subunit (glyQ)
MYLQDVIMKLNDFWASKGCLLEQPYDMEVGAGTFHPATFFGSLRKGPWKVAYVQPSRRPT
DGRYGENPNRLQRYFQYQVIIKPSPENSQELYLESLEYLGINLKEHDIRFVEDNWESPTL
GAWGVGWEVWLDGMEITQFTYFQQIGGISLKDIPLEITYGLERIAMYLQGVDNVYEVQWN
ENVKYGDVFLENEREFSVFNFEEANVGLLFRHFDEYEKEFYRLVEKNLYLPAYDYILKCS
HTFNLLDARGAISVSQRQTYVKRIQAMARKAARVFLEVQANENSPA

CDS  cDNA 858 bp
   1 atgtatcttc aggatgtgat aatgaaactg aacgatttct gggcgtctaa aggttgtctg    60
  61 cttgaacaac cttacgatat ggaagtcggt gccggaacgt ttcaccccgc tacgttcttt   120
 121 ggtagcctga gaaagggtcc ttggaaagtg gcctacgttc agccaagcag aaggccgacc   180
 181 gatggtagat atggagagaa tcccaacaga ttgcagaggt acttccagta ccaggtgatc   240
 241 ataaaaccct cccctgaaaa ctctcaagaa ctgtatcttg agtccctgga gtacctcggt   300
 301 ataaacctga aggaacacga catcagattc gtggaggaca attgggaatc tcccaccctc   360
 361 ggagcgtggg gtgttggttg ggaagtgtgg ttagacggca tggagataac ccagttcaca   420
 421 tatttccagc agattggtgg aatttccctg aaggacattc ctctcgagat aacctacggg   480
 481 ctggaaagga tcgccatgta tcttcaggga gtcgataacg tttacgaggt acagtggaat   540
 541 gaaaacgtga aatacggtga tgtgttcctt gaaaacgaaa gagaattttc ggttttcaac   600
 601 ttcgaagaag ccaacgtagg actccttttc agacatttcg atgagtacga gaaggagttt   660
 661 tacagacttg tggaaaaaaa tctttacctt cccgcttacg attacatttt gaaatgttct   720
 721 cacacgttca atcttctcga tgcgcgcgga gcgataagtg tgtctcagcg acaaacctac   780
 781 gtgaaacgta ttcaggcgat ggcaagaaag gctgcgagag tttttctgga ggtgcaggct   840
 841 aatgagaaca gccctgct   858
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
230581 231441 1 Glimmer3 score 10.29 poor
Genemark probabilities .89   .67 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu