LOADING...
   TM0215;TM0215
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0215    TM0215            JCSG 282095 PDB Deposition 05-SEP-19              PDB id: 2b33

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0215
DESCRIPTIONPutative endoribonuclease [YjgF/L-PSP]
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WY58_THEMA
DR SPTR; Q9WY58 (flat text); Q9WY58 (good view)
DR GenBank; AAD35307
DR Pfam; PF01042; Ribonuc_L-PSP;
DR Interpro; IPR006175; Endoribon_LPSP;
DR Interpro; IPR006056; YjgF-like;
DR PDB; 2B33; Identical; 27-SEP-05; PROTEIN SYNTHESIS INHIBITOR, PUTATIVE;
DR PDB; 2DYY; Highly similar; 19-MAR-07; UPF0076 PROTEIN PH0854;
DR PDB; 1XRG; Highly similar; 14-DEC-04; PUTATIVE TRANSLATION INITIATION INHIBITOR, YJGF FAMILY;
DR PDB; 1QD9; Highly similar; 26-NOV-99; PURINE REGULATORY PROTEIN YABJ;
DR PDB; 2CSL; Highly similar; 22-NOV-05; PROTEIN TRANSLATION INTIATION INHIBITOR;
DR PDB; 2CVL; Highly similar; 08-DEC-05; PROTEIN TRANSLATION INITIATION INHIBITOR;
DR PDB; 2CW4; Highly similar; 16-DEC-05; TRANSLATION INITIATION INHIBITOR;
DR PDB; 2UYJ; Highly similar; 29-MAY-07; PROTEIN TDCF;
DR KEGG; 3.1.-.-; Enzyme page
DR FFAS; 282095; Fold and function assignment.
DR TVPC; TM0215; Homologs in PDB, JCSG and SG center.
DR OVP; TM0215; Ortholog view popup.
DR TPM; TM0215; Target PDB monitor.
DR FSS; TM0215; Target function coverage.
PROPERTY Residues: 128 aa
Molecule Weight: 14267.64 Dalton
Isoelectric Point: 5.12
Extinction Coefficient: 5960
Gravy Index: -.15
Number of Met residues: 4
Percentage of Met residues: 3.12 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 128 aa
>TM0215  TM0215 protein synthesis inhibitor, putative
MKRFVETDKAPKAIGPYSQAVVVGNMMFVSGQIPIDPETGELVQGTIEEKTERVLENLKA
ILEAGGFSLKDVVKVTVFTTSMDYFQRVNEVYSRYFGDHRPARSFVAVAQLPRNVEIEIE
AIAVKEGE

CDS  cDNA 384 bp
   1 atgaagcgct ttgtcgaaac cgataaggct ccaaaggcca taggcccgta ctctcaggcg    60
  61 gtcgttgtcg gaaacatgat gttcgtttcg ggtcaaattc ccatagatcc agaaaccggt   120
 121 gaactcgttc agggtaccat agaagaaaag actgagagag ttctggaaaa tctgaaagca   180
 181 atactggagg cgggcggttt ctccctgaaa gacgtcgtga aggtgacggt gtttacgacc   240
 241 agtatggact acttccagag agtcaacgag gtgtattcca gatactttgg agaccacagg   300
 301 cccgctaggt cgtttgtggc ggttgctcag ctcccgagaa acgtagaaat agaaatagaa   360
 361 gcgatcgctg tgaaggaagg ggag   384
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
230191 230577 1 Glimmer3 score 11.57 poor
Genemark probabilities .91   .92 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu