LOADING...
   TM0212;TM0212
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0212    TM0212            JCSG 282092 PDB Deposition 08-OCT-31              PDB id: 2ka7, 1zko

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0212
DESCRIPTIONPutative glycine cleavage system H protein
ORGANISMThermotoga maritima
COMMENTSupported by the conserved genomic cluster (operon)

-!- FUNCTION: THE GLYCINE CLEAVAGE SYSTEM CATALYZES THE DEGRADATION
OF
GLYCINE. THE H PROTEIN SHUTTLES THE METHYLAMINE GROUP OF GLYCINE
FROM THE P PROTEIN TO THE T PROTEIN (BY SIMILARITY).
-!- COFACTOR: THE H CHAIN CONTAINS A COVALENTLY-BOUND LIPOYL
COFACTOR
(BY SIMILARITY).
-!- SUBUNIT: THE GLYCINE CLEAVAGE SYSTEM IS COMPOSED OF FOUR
PROTEINS:
P, T, L, AND H (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE GCVH FAMILY.
-!- SIMILARITY: CONTAINS 1 LIPOYL-BINDING DOMAIN.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; GCSH_THEMA
DR SPTR; Q9WY55 (flat text); Q9WY55 (good view)
DR GenBank; AAD35304
DR Pfam; PF01597; GCV_H;
DR Interpro; IPR002930; GCV_H;
DR Interpro; IPR003016; Lipoyl_BS;
DR PDB; 2KA7; Identical; 13-JAN-09; GLYCINE CLEAVAGE SYSTEM H PROTEIN;
DR PDB; 1ZKO; Identical; 10-MAY-05; GLYCINE CLEAVAGE SYSTEM H PROTEIN;
DR PDB; 1ONL; Highly similar; 26-AUG-03; GLYCINE CLEAVAGE SYSTEM H PROTEIN;
DR PDB; 3MXU; Highly similar; 26-MAY-10; GLYCINE CLEAVAGE SYSTEM H PROTEIN;
DR PDB; 3A8I; Highly similar; 07-APR-10; AMINOMETHYLTRANSFERASE;
DR PDB; 3A8J; Highly similar; 07-APR-10; AMINOMETHYLTRANSFERASE;
DR PDB; 3A8K; Highly similar; 07-APR-10; AMINOMETHYLTRANSFERASE;
DR PDB; 3AB9; Highly similar; 07-APR-10; GLYCINE CLEAVAGE SYSTEM H PROTEIN;
DR KEGG; 1.; Enzyme page
DR FFAS; 282092; Fold and function assignment.
DR TVPC; TM0212; Homologs in PDB, JCSG and SG center.
DR OVP; TM0212; Ortholog view popup.
DR TPM; TM0212; Target PDB monitor.
DR FSS; TM0212; Target function coverage.
PROPERTY Residues: 124 aa
Molecule Weight: 13913.92 Dalton
Isoelectric Point: 4.4
Extinction Coefficient: 16960
Gravy Index: -.51
Number of Met residues: 3
Percentage of Met residues: 2.42 %
Number of Cys residues: 1
Percentage of Cys residues: 0.81 %
SEQUENCE  amino acids 124 aa
>TM0212  TM0212 glycine cleavage system H protein (gcvH)
MKMKKYTKTHEWVSIEDKVATVGITNHAQEQLGDVVYVDLPEVGREVKKGEVVASIESVK
AAADVYAPLSGKIVEVNEKLDTEPELINKDPEGEGWLFKMEISDEGELEDLLDEQAYQEF
CAQE

CDS  cDNA 372 bp
   1 ttgaagatga aaaagtacac gaaaactcac gaatgggtgt cgattgagga caaagtagca    60
  61 acggttggaa taacgaatca cgctcaggaa cagctcggcg atgtggtcta cgtggatctt   120
 121 cctgaagtcg gcagagaggt gaagaaaggg gaagttgtgg cgagtataga gtctgtgaaa   180
 181 gccgcagcgg acgtgtacgc tcctctcagt gggaagatcg tggaagtgaa cgagaaactc   240
 241 gatactgaac ctgaactcat aaacaaggat ccagaaggag aaggctggct tttcaaaatg   300
 301 gaaatatccg atgaaggcga actcgaagat cttctggatg aacaggctta tcaggaattc   360
 361 tgtgctcagg ag   372
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
227052 227426 3 Glimmer3 score - -
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu