LOADING...
   TM0208;TM0208
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0208    TM0208            JCSG 282088 MR Tracing 05-FEB-03

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0208
DESCRIPTIONPyruvate kinase (EC 2.7.1.40)
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; KPYK_THEMA
DR SPTR; Q9WY51 (flat text); Q9WY51 (good view)
DR GenBank; AAD35300
DR Pfam; PF00224; PK;
DR Pfam; PF02887; PK_C;
DR Interpro; IPR001697; Pyruvate_kinase;
DR PDB; 4YNG; Highly similar; 25-MAR-15; PYRUVATE KINASE I;
DR PDB; 2E28; Highly similar; 05-FEB-08; PYRUVATE KINASE;
DR PDB; 1PKY; Highly similar; 07-DEC-95; PYRUVATE KINASE;
DR PDB; 1E0U; Highly similar; 11-APR-00; PYRUVATE KINASE;
DR PDB; 1E0T; Highly similar; 11-APR-00; PYRUVATE KINASE;
DR PDB; 3T05; Highly similar; 26-OCT-11; PYRUVATE KINASE;
DR PDB; 3T07; Highly similar; 26-OCT-11; PYRUVATE KINASE;
DR PDB; 3T0T; Highly similar; 06-JUN-12; PYRUVATE KINASE;
DR KEGG; 2.7.1.40; Enzyme page
DR FFAS; 282088; Fold and function assignment.
DR TVPC; TM0208; Homologs in PDB, JCSG and SG center.
DR OVP; TM0208; Ortholog view popup.
DR TPM; TM0208; Target PDB monitor.
DR FSS; TM0208; Target function coverage.
PROPERTY Residues: 466 aa
Molecule Weight: 51889.6 Dalton
Isoelectric Point: 6.13
Extinction Coefficient: 22920
Gravy Index: -.13
Number of Met residues: 6
Percentage of Met residues: 1.29 %
Number of Cys residues: 3
Percentage of Cys residues: 0.64 %
SEQUENCE  amino acids 466 aa
>TM0208  TM0208 pyruvate kinase
MRSTKIVCTVGPRTDSYEMIEKMIDLGVNVFRINTSHGDWNEQEQKILKIKDLREKKKKP
VAILIDLAGPKIRTGYLEKEFVELKEGQIFTLTTKEILGNEHIVSVNLSSLPKDVKKGDT
ILLSDGEIVLEVIETTDTEVKTVVKVGGKITHRRGVNVPTADLSVESITDRDREFIKLGT
LHDVEFFALSFVRKPEDVLKAKEEIRKHGKEIPVISKIETKKALERLEEIIKVSDGIMVA
RGDLGVEIPIEEVPIVQKEIIKLSKYYSKPVIVATQILESMIENPFPTRAEVTDIANAIF
DGADALLLTAETAVGKHPLEAIKVLSKVAKEAEKKLEFFRTIEYDTSDISEAISHACWQL
SESLNAKLIITPTISGSTAVRVSKYNVSQPIVALTPEEKTYYRLSLVRKVIPVLAEKCSQ
ELEFIEKGLKKVEEMGLAEKGDLVVLTSGVPGKVGTTNTIRVLKVD

CDS  cDNA 1398 bp
   1 gtgcgaagta caaagatcgt atgtacggtc ggaccaagaa cagacagcta tgaaatgata    60
  61 gaaaagatga tagaccttgg agtgaacgtc ttcagaataa acacctcaca tggtgactgg   120
 121 aacgagcagg aacagaaaat actcaaaata aaagatctga gagagaaaaa gaaaaaaccc   180
 181 gtagccattc tgatcgatct tgcggggccg aagatcagaa ccggatacct cgaaaaagag   240
 241 tttgtggaat taaaagaagg ccagatcttc actctcacca caaaggaaat acttggaaac   300
 301 gaacacatag tctcggtgaa tctcagctct cttccaaagg acgtgaagaa aggagacacc   360
 361 attctgctga gcgatggaga gatagtgctt gaggtaattg aaacaaccga tacagaagtg   420
 421 aaaacagtgg tgaaagtcgg tggaaagatc acacacagga gaggtgtgaa cgtaccgacg   480
 481 gccgatcttt cggtggaatc cataacggac agagacagag aattcataaa actcggaacg   540
 541 ttgcatgacg ttgaattttt cgctctttct tttgtgagaa agccagagga cgtgctcaag   600
 601 gcaaaagaag agatcagaaa acacggaaag gaaatacctg taatctccaa aatagaaacg   660
 661 aaaaaggctc tggagcgtct cgaggagata ataaaggtga gcgatggaat catggtcgca   720
 721 cgcggtgacc tgggagtgga gatacccata gaagaagtcc ccatcgttca gaaagaaatc   780
 781 atcaaactct ccaagtacta ctccaaacca gtcatagtcg caactcagat actcgaatcg   840
 841 atgatagaaa atccgttccc cacgagggca gaggtcaccg acatagccaa cgccatcttc   900
 901 gatggagcgg acgccctgct cctcacagcg gaaacagcgg ttggaaaaca tcccctggaa   960
 961 gccataaagg tgctgagtaa agtagcaaaa gaagccgaaa aaaaactgga atttttcaga  1020
1021 acgatagaat acgataccag cgacatatct gaggctatat cacacgcctg ctggcagctc  1080
1081 tctgaatctc tgaacgcgaa gctgatcatc acacctacca tatccgggag taccgctgtt  1140
1141 cgtgtttcaa agtacaacgt ttctcaaccc attgtggccc tgacaccaga agagaaaacc  1200
1201 tactacagac tttctctcgt gaggaaggtg atacccgttc tcgctgaaaa atgttcccag  1260
1261 gaattagagt ttatcgaaaa agggctgaag aaagtagaag aaatgggttt ggcagaaaaa  1320
1321 ggggatctgg tggttctcac ttccggcgtt ccaggaaagg tgggaacgac aaacaccata  1380
1381 agggtgttga aggtggat  1398
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
223226 224626 -2 Glimmer3 score - -
Genemark probabilities .95   .01 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu