LOADING...
   TM0207;TM0207
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0207    TM0207            JCSG 282087 PDB Deposition 04-MAR-11              PDB id: 1vjn

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0207
DESCRIPTIONPutative Zn-dependent hydrolase of the metallo-beta-lactamase superfamily [Metallo-hydrolase/oxidoreductase]
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WY50_THEMA
DR SPTR; Q9WY50 (flat text); Q9WY50 (good view)
DR GenBank; AAD35299
DR PDB; 1VJN; Identical; 16-MAR-04; ZN-DEPENDENT HYDROLASE OF METALLO-BETA-LACTAMASE SUPERFAMILY;
DR KEGG; 3.; Enzyme page
DR FFAS; 282087; Fold and function assignment.
DR TVPC; TM0207; Homologs in PDB, JCSG and SG center.
DR OVP; TM0207; Ortholog view popup.
DR TPM; TM0207; Target PDB monitor.
DR FSS; TM0207; Target function coverage.
PROPERTY Residues: 208 aa
Molecule Weight: 23360.8 Dalton
Isoelectric Point: 5.87
Extinction Coefficient: 14440
Gravy Index: -.13
Number of Met residues: 4
Percentage of Met residues: 1.92 %
Number of Cys residues: 2
Percentage of Cys residues: 0.96 %
SEQUENCE  amino acids 208 aa
>TM0207  TM0207 conserved hypothetical protein
MKITWFGHACFALEMEGKTIVTDPFDESVGYPIPNVTADVVTESHQHFDHNAHHLVKGNF
RVIDRPGAYTVNGVKIKGVETFHDPSHGRERGKNIVFVFEGEGIKVCHLGDLGHVLTPAQ
VEEIGEIDVLLVPVGGTYTIGPKEAKEVADLLNAKVIIPMHYKTKYLKFNLLPVDDFLKL
FDSYERVGNILELFEKPKERKVVVMEVQ

CDS  cDNA 624 bp
   1 atgaagatca cctggtttgg acacgcatgc ttcgccctgg agatggaagg aaaaacgatc    60
  61 gttacagatc ctttcgatga gagtgtggga tatcccatac caaacgtaac cgctgatgtt   120
 121 gtaacggaaa gtcatcagca tttcgatcac aacgctcacc atcttgtgaa gggaaacttc   180
 181 cgtgtgatag acagacccgg tgcttacacc gtgaacggtg tgaaaataaa aggtgtggag   240
 241 acctttcacg acccatcgca tggaagagaa aggggcaaaa acatcgtctt cgtattcgaa   300
 301 ggggaaggca taaaagtatg ccacctggga gaccttggac acgtgcttac ccccgctcag   360
 361 gtagaagaaa taggtgagat cgatgtcctg ctggtacccg tcggtggaac ttacaccatt   420
 421 gggccaaagg aggcaaagga agtagcggat ttgctgaacg cgaaagtcat cattccgatg   480
 481 cactacaaga cgaagtacct gaaattcaat ctcctgcccg ttgatgattt tttgaaactc   540
 541 ttcgattcgt acgaacgtgt gggaaacatc ctcgagctct ttgaaaagcc gaaagaaaga   600
 601 aaagtagtcg tcatggaggt gcag   624
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
222587 223213 -2 Glimmer3 score 10.44 poor
Genemark probabilities .85   .93 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu