LOADING...
   TM0189;TM0189
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0189    TM0189            JCSG 358402 PDB Deposition 05-OCT-27              PDB id: 2etv

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0189
DESCRIPTIONPutative periplasmic Fe(III) ABC transporter.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WY32_THEMA
DR SPTR; Q9WY32 (flat text); Q9WY32 (good view)
DR GenBank; AAD35281
DR Pfam; PF01497; Peripla_BP_2;
DR Interpro; IPR002491; Peripla_BP;
DR PDB; 2ETV; Identical; 07-FEB-06; IRON(III) ABC TRANSPORTER, PERIPLASMIC IRON-BINDI PROTEIN, P;
DR FFAS; 282069; Fold and function assignment.
DR TVPC; TM0189; Homologs in PDB, JCSG and SG center.
DR OVP; TM0189; Ortholog view popup.
DR TPM; TM0189; Target PDB monitor.
DR FSS; TM0189; Target function coverage.
PROPERTY Residues: 358 aa
Molecule Weight: 40067.91 Dalton
Isoelectric Point: 5.11
Extinction Coefficient: 40800
Gravy Index: -.07
Number of Met residues: 3
Percentage of Met residues: 0.84 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 358 aa
>TM0189  TM0189 iron(III) ABC transporter, periplasmic iron-binding protein, putative
MKFKVFISVFLILSVALFSEGIVIKDLLGREVEIPSNVNRIVAVGPGALRLIAYLKATDM
VVGVEDFEKLRPYGRPYILAYPELKKLPSVGPGGPGKLPDLESLITLQPDVVFITYVDRK
TAKDIQEKTGIPVVVLSYGNLGTFEDEDLFRSIELAGKILGREERAHEVVDFIRKAQEDL
VTRSEGVESPTVYVGGIGYKGAHGIDSTEAKYPPFVVLHARNVVDELGEGHKFIDPEKLL
VWNPEYIFIDENGLSLVLDDYSKHREFYESLSAVKRGKVYGILPYNYYTTNIGTALADAY
FIGKVLYPERFTDIDPEEKADEIYEFLLGKRVYGEMAEQFGGFGKIDLPSGRILRGTW

CDS  cDNA 1074 bp
   1 atgaaattca aggtttttat ctctgttttt ctgattctct cggtcgcgtt gttttcggaa    60
  61 ggaatcgtga taaaagatct tcttggaaga gaagtggaga ttccttcgaa cgtgaatcga   120
 121 atcgtggcag tgggtcccgg ggcgctcagg ttgattgcgt atttgaaagc caccgatatg   180
 181 gttgtcggtg tggaagactt tgagaaactc agaccttacg ggaggccata catacttgcg   240
 241 tatccggagc tcaagaaact tccgagtgtt ggtcctggag gaccgggaaa gcttccagat   300
 301 ctggagtctt tgataaccct gcaacccgac gttgtcttca tcacgtacgt tgacaggaag   360
 361 acggcgaagg acatacagga gaaaacgggg attcctgttg tcgttctcag ttatgggaat   420
 421 ctggggacat ttgaagacga ggatctcttc agatcgatcg agctggcggg aaagattctt   480
 481 ggaagagaag aaagggccca tgaagtggtt gatttcataa ggaaagcgca ggaggatctc   540
 541 gtaactcgat ctgagggtgt cgaaagccct accgtctacg ttggtggaat cggatacaaa   600
 601 ggagctcatg gaatcgatag cacggaggcg aagtatcctc ctttcgtggt cctacacgcg   660
 661 aggaacgttg tggacgaact gggagaagga cacaaattca tagatcctga gaagctactc   720
 721 gtttggaatc cagagtacat tttcatcgat gaaaacggtt tgagcctcgt actggacgat   780
 781 tattcgaaac acagagaatt ctacgagagt ttgagtgctg tcaaaagagg aaaagtttac   840
 841 ggcattctcc cttacaatta ctacaccacc aacattggaa cggctctggc cgatgcgtac   900
 901 ttcatcggaa aggttctcta tcccgaacgt tttaccgata tcgatccaga ggaaaaggcg   960
 961 gatgaaattt atgaattcct cctcgggaaa agggtttacg gggagatggc tgagcaattt  1020
1021 ggaggatttg gaaagataga tcttccttca ggaaggatcc tccgtggaac gtgg  1074
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
202872 203948 3 Glimmer3 score 13.06 good
Genemark probabilities .9   .16 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu