LOADING...
   TM0166;TM0166
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0166    TM0166            JCSG 282046 PDB Deposition 03-OCT-10              PDB id: 1o5z

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0166
DESCRIPTIONDihydrofolate synthase (EC 6.3.2.12) / Folylpolyglutamate synthase (EC 6.3.2.17)
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: CONVERSION OF FOLATES TO POLYGLUTAMATE DERIVATIVES.
-!- CATALYTIC ACTIVITY: ATP + TETRAHYDROFOLYL-[GLU][N] + L-GLUTAMATE =
ADP + ORTHOPHOSPHATE + TETRAHYDROFOLYL-[GLU][N+1].
-!- SIMILARITY: BELONGS TO THE FOLYLPOLYGLUTAMATE SYNTHASE FAMILY.
DR UNIPROT; Q9WY13_THEMA
DR SPTR; Q9WY13 (flat text); Q9WY13 (good view)
DR GenBank; AAD35259
DR Pfam; PF02875; Mur_ligase_C;
DR Interpro; IPR001645; Fpolygl_synthtse;
DR Interpro; IPR000713; Mur_ligase;
DR Interpro; IPR004101; Mur_ligase_C;
DR PDB; 1O5Z; Identical; 11-NOV-03; FOLYLPOLYGLUTAMATE SYNTHASE/DIHYDROFOLATE SYNTHASE;
DR PDB; 1FGS; Highly similar; 04-MAY-99; FOLYLPOLYGLUTAMATE SYNTHETASE;
DR PDB; 1JBV; Highly similar; 19-SEP-01; FOLYLPOLYGLUTAMATE SYNTHASE;
DR PDB; 1JBW; Highly similar; 19-SEP-01; FOLYLPOLYGLUTAMATE SYNTHASE;
DR PDB; 2GCA; Highly similar; 27-JUN-06; FOLYLPOLYGLUTAMATE SYNTHASE;
DR PDB; 2GC6; Highly similar; 27-JUN-06; FOLYLPOLYGLUTAMATE SYNTHASE;
DR PDB; 2GCB; Highly similar; 27-JUN-06; FOLYLPOLYGLUTAMATE SYNTHASE;
DR PDB; 2GC5; Highly similar; 27-JUN-06; FOLYLPOLYGLUTAMATE SYNTHASE;
DR KEGG; 6.3.2.12/6.3.2.17; Enzyme page
DR FFAS; 282046; Fold and function assignment.
DR TVPC; TM0166; Homologs in PDB, JCSG and SG center.
DR OVP; TM0166; Ortholog view popup.
DR TPM; TM0166; Target PDB monitor.
DR FSS; TM0166; Target function coverage.
PROPERTY Residues: 430 aa
Molecule Weight: 48865.97 Dalton
Isoelectric Point: 6.55
Extinction Coefficient: 36330
Gravy Index: -.24
Number of Met residues: 13
Percentage of Met residues: 3.02 %
Number of Cys residues: 2
Percentage of Cys residues: 0.47 %
SEQUENCE  amino acids 430 aa
>TM0166  TM0166 folylpolyglutamate synthase/dihydrofolate synthase (folC)
MAYLEVLRYLYHKRPMGKVKPGLERISMLLSKLGNPHLEYKTIHIGGTNGKGSVANMVSN
ILVSQGYRVGSYYSPHLSTFRERIRLNEEYISEEDVVKIYETMEPILNELDKEEIFSPSF
FEVVTAMAFLYFAEKNVDIAVLEVGLGGRLDATNVVFPLCSTIVTVDRDHEKTLGYTIEQ
IAWEKSGIIKERVPLVTGERKREALKVMEDVARKKSSRMYVIDKDFSVKVKSLKLHENRF
DYCGENTFEDLVLTMNGPHQIENAGVALKTLEATGLPLSEKAIREGLKNAKNLGRFEILE
KNGKMYILDGAHNPHGAESLVRSLKLYFNGEPLSLVIGILDDKNREDILRKYTGIFERVI
VTRVPSPRMKDMNSLVDMAKKFFKNVEVIEDPLEAIESTERATVVTGSLFLVGYVREFLT
TGKINEEWKL

CDS  cDNA 1290 bp
   1 atggcatacc tcgaagttct caggtatctc taccacaaaa gacctatggg aaaggtgaaa    60
  61 ccaggtcttg agaggatctc aatgctactt tcaaagctgg gaaatcccca tctggaatac   120
 121 aaaaccatac acataggtgg cacgaacgga aagggttctg ttgcaaacat ggtcagtaac   180
 181 attctggtat ctcaagggta cagagtggga tcatattact cccctcatct gagcacgttc   240
 241 agagaaagga taaggttaaa cgaagagtac atatccgaag aggacgtggt gaagatctac   300
 301 gaaacaatgg agccgattct gaacgagctc gacaaagaag aaatattctc cccaagcttt   360
 361 tttgaagttg taacggcgat ggcttttctc tatttcgcgg aaaaaaacgt tgacattgcc   420
 421 gtcctggaag ttggtcttgg aggcagactg gacgcaacga acgtggtgtt ccctctttgt   480
 481 tccaccattg tcacggtgga cagagatcac gaaaaaacgt tgggatacac catagaacag   540
 541 atcgcatggg aaaaatccgg aataataaaa gaaagagttc cccttgtgac aggggaaaga   600
 601 aaaagagaag ccctcaaagt gatggaagat gttgcccgaa agaagagctc aaggatgtac   660
 661 gtcatcgaca aggatttttc cgttaaggtt aaatctctga aacttcacga aaacagattc   720
 721 gattactgtg gggaaaacac cttcgaagat ctcgtcctga ccatgaacgg tcctcaccag   780
 781 atagaaaacg ccggtgttgc cctgaagact cttgaagcaa caggacttcc gttgagcgag   840
 841 aaagcaatac gcgaaggctt gaaaaatgcg aagaatctgg gaagatttga aatcttagag   900
 901 aaaaacggga agatgtacat cctcgatgga gcgcacaacc ctcacggagc ggaaagcctt   960
 961 gtcagaagct tgaaattgta cttcaacggc gaacccttga gcctggtaat aggtattctg  1020
1021 gacgacaaga accgggagga cattcttcga aagtacaccg gaatcttcga aagggtcata  1080
1081 gtcacccgtg ttccttcacc tcgtatgaaa gacatgaaca gccttgttga catggcaaag  1140
1141 aaattcttca aaaacgtgga agtcatagaa gatcccctgg aagcgatcga atctactgaa  1200
1201 agagccacgg ttgttacagg atcactgttt ctagtgggat acgtaaggga gttcctgaca  1260
1261 accggaaaga taaatgagga gtggaaacta  1290
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
171412 172704 -1 Glimmer3 score - -
Genemark probabilities .95   .84 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu