LOADING...
   TM0161;TM0161
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0161    TM0161            JCSG 282041 PDB Deposition 06-JAN-25              PDB id: 2ftz

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0161
DESCRIPTIONGeranyltranstransferase (EC 2.5.1.10)
ORGANISMThermotoga maritima
COMMENTIsoprenoid biosynthesis:
geranyl diphosphate + isopentenyl diphosphate = diphosphate + trans,trans-farnesyl
diphosphate
DR UNIPROT; Q9WY08_THEMA
DR SPTR; Q9WY08 (flat text); Q9WY08 (good view)
DR GenBank; AAD35254
DR Pfam; PF00348; polyprenyl_synt;
DR Interpro; IPR000092; Polyprenyl_synt;
DR PDB; 2FTZ; Identical; 07-FEB-06; GERANYLTRANSTRANSFERASE;
DR PDB; 4WK5; Highly similar; 19-NOV-14; GERANYLTRANSTRANSFERASE;
DR PDB; 4KKM; Highly similar; 15-MAY-13; POLYPRENYL SYNTHETASE;
DR PDB; 4LLS; Highly similar; 24-JUL-13; GERANYLTRANSTRANSFERASE;
DR PDB; 4LLT; Highly similar; 24-JUL-13; GERANYLTRANSTRANSFERASE;
DR PDB; 3KRA; Highly similar; 23-FEB-10; GERANYL DIPHOSPHATE SYNTHASE LARGE SUBUNIT;
DR PDB; 3KRC; Highly similar; 23-FEB-10; GERANYL DIPHOSPHATE SYNTHASE LARGE SUBUNIT;
DR PDB; 3KRF; Highly similar; 23-FEB-10; GERANYL DIPHOSPHATE SYNTHASE LARGE SUBUNIT;
DR KEGG; 2.5.1.10; Enzyme page
DR FFAS; 282041; Fold and function assignment.
DR TVPC; TM0161; Homologs in PDB, JCSG and SG center.
DR OVP; TM0161; Ortholog view popup.
DR TPM; TM0161; Target PDB monitor.
DR FSS; TM0161; Target function coverage.
PROPERTY Residues: 272 aa
Molecule Weight: 31022.42 Dalton
Isoelectric Point: 5.41
Extinction Coefficient: 15930
Gravy Index: -.2
Number of Met residues: 9
Percentage of Met residues: 3.31 %
Number of Cys residues: 2
Percentage of Cys residues: 0.74 %
SEQUENCE  amino acids 272 aa
>TM0161  TM0161 geranyltranstransferase (ispA)
MKKEKVEERIREILRPGWDLLTEEAMLYSATVGGKRIRPLLVLTLGEDLGVEEEKLLDVA
VAVELFHTASLIHDDLPPIDNADFRRGKPSCHRTYGEDIALLAGDGLFFLAFSQISKIGN
SKIFEEFSETAYKLLLGEAMDVEFERRKMEVSQEMVERMYAFKTGALFAFCFSAPFILKG
KDHTKMKLLGEKFGVAFQIYDDLKDILGSFEKVGKDLGKDTEKVTLVKKVGIQKAREMAD
KYYEEVLKGIESEGLFRTLFLLKELKQMVEER

CDS  cDNA 816 bp
   1 atgaagaagg agaaagttga agaaagaata cgcgagattt tgaggcctgg atgggatctt    60
  61 ctcacagaag aagccatgct gtactccgcg acggttggag gaaagaggat ccgtcctctc   120
 121 ctcgtcttga cactgggtga ggatttggga gtggaagagg aaaaacttct cgatgtggcg   180
 181 gtggccgttg aactctttca cacggcttct ctgatacacg atgatcttcc cccaatagat   240
 241 aacgcggatt ttcgaagagg gaagccttct tgtcacagga cctatggtga agatatcgcc   300
 301 cttcttgcgg gagatggtct gttcttcctc gctttttctc agatatctaa aatcggaaat   360
 361 tcaaagattt ttgaagagtt ttcggaaacg gcctacaaac ttcttttggg ggaagcgatg   420
 421 gatgtggaat tcgaaagaag aaagatggaa gtctcgcagg agatggtgga gagaatgtac   480
 481 gctttcaaaa cgggagcgct atttgctttc tgtttctcag ctccatttat cctgaaagga   540
 541 aaggatcaca ccaagatgaa actcctcgga gagaagttcg gggtggcttt ccagatatac   600
 601 gacgatctga aagacattct tgggtctttc gaaaaggtgg gaaaggacct cggaaaagac   660
 661 acagaaaaag tgacgcttgt gaaaaaggtg gggattcaga aagctcgtga gatggccgat   720
 721 aagtattatg aagaagtttt gaaaggtatc gaatcagaag gtctctttcg cacgctgttt   780
 781 cttctgaaag aactcaaaca gatggtggag gagaga   816
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
166136 166954 2 Glimmer3 score 13.57 good
Genemark probabilities .77   .89 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu