LOADING...
   TM0160;TM0160
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0160    TM0160            JCSG 282040 PDB Deposition 04-MAR-10              PDB id: 1vjl, 1sj5

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0160
DESCRIPTIONPutative bifunctional nuclease, DNase-RNase family, PF02577
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WY07_THEMA
DR SPTR; Q9WY07 (flat text); Q9WY07 (good view)
DR GenBank; AAD35253
DR Pfam; PF02577; DNase-RNase;
DR Interpro; IPR003729; DUF151;
DR PDB; 1VJL; Identical; 16-MAR-04; HYPOTHETICAL PROTEIN TM0160;
DR PDB; 1SJ5; Identical; 01-MAR-05; CONSERVED HYPOTHETICAL PROTEIN TM0160;
DR FFAS; 282040; Fold and function assignment.
DR TVPC; TM0160; Homologs in PDB, JCSG and SG center.
DR OVP; TM0160; Ortholog view popup.
DR TPM; TM0160; Target PDB monitor.
DR FSS; TM0160; Target function coverage.
PROPERTY Residues: 181 aa
Molecule Weight: 20550.23 Dalton
Isoelectric Point: 4.52
Extinction Coefficient: 13980
Gravy Index: -.25
Number of Met residues: 4
Percentage of Met residues: 2.21 %
Number of Cys residues: 1
Percentage of Cys residues: 0.55 %
SEQUENCE  amino acids 181 aa
>TM0160  TM0160 conserved hypothetical protein
MRKAWVKTLALDRVSNTPVVILGIEGTNRVLPIWIGACEGHALALAMEKMEFPRPLTHDL
LLSVLESLEARVDKVIIHSLKDNTFYATLVIRDLTYTDEEDEEAALIDIDSRPSDAIILA
VKTGAPIFVSDNLVEKHSIELEVNETQDEEEEFKKFVENLNIDTFKQMIEKKREEDEEGE
S

CDS  cDNA 543 bp
   1 ttgaggaagg catgggtgaa gactctggcg ctcgatagag tgagtaacac gccagtagtt    60
  61 attctcggca ttgaaggtac aaatagagtg cttcccatct ggataggagc gtgtgaaggg   120
 121 catgctctgg ccctcgcgat ggagaagatg gagtttccac gccctctgac tcacgatctc   180
 181 cttttgagtg ttcttgaatc tcttgaagca cgcgtggata aggtgatcat tcactctttg   240
 241 aaggataaca ccttctacgc aaccctcgtg ataagagatc tcacgtacac ggacgaggaa   300
 301 gatgaagagg ctgctttgat agatatcgat tccagacctt ccgatgcgat catactcgct   360
 361 gtgaagaccg gggcacccat tttcgtatcg gacaatctgg tggagaaaca ctctatcgag   420
 421 ttggaagtaa acgaaacaca ggacgaggaa gaggaattca agaagttcgt tgaaaatctg   480
 481 aacatagata cgttcaaaca gatgatagaa aagaagaggg aagaagatga agaaggagaa   540
 541 agt   543
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
165610 166155 1 Glimmer3 score - -
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu