LOADING...
   TM0159;TM0159
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0159    TM0159            JCSG 282039 PDB Deposition 04-OCT-06              PDB id: 1vp2

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0159
DESCRIPTIONPutative Xanthosine triphosphate pyrophosphatase (EC 3.6.1.-)/HAM1 protein homolog [ITPase (Ham1)].
ORGANISMThermotoga maritima
COMMENT-!- SIMILARITY: BELONGS TO THE HAM1 NTPASE FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; NTPA_THEMA
DR SPTR; Q9WY06 (flat text); Q9WY06 (good view)
DR GenBank; AAD35252
DR Pfam; PF01725; Ham1p_like;
DR Interpro; IPR002637; Ham1p_like;
DR PDB; 1VP2; Identical; 26-OCT-04; PUTATIVE XANTHOSINE TRIPHOSPHATE PYROPHOSPHATASE/ PROTEIN HO;
DR PDB; 3S86; Identical; 06-JUN-12; NUCLEOSIDE-TRIPHOSPHATASE;
DR PDB; 4BNQ; Highly similar; 29-MAY-13; NON-CANONICAL PURINE NTP PYROPHOSPHATASE;
DR PDB; 3TQU; Highly similar; 21-SEP-11; NON-CANONICAL PURINE NTP PYROPHOSPHATASE;
DR PDB; 1V7R; Highly similar; 30-DEC-03; HYPOTHETICAL PROTEIN PH1917;
DR PDB; 2DVN; Highly similar; 04-SEP-07; HYPOTHETICAL PROTEIN PH1917;
DR PDB; 2DVO; Highly similar; 04-SEP-07; HYPOTHETICAL PROTEIN PH1917;
DR PDB; 2DVP; Highly similar; 04-SEP-07; HYPOTHETICAL PROTEIN PH1917;
DR KEGG; 3.6.1.-; Enzyme page
DR FFAS; 282039; Fold and function assignment.
DR TVPC; TM0159; Homologs in PDB, JCSG and SG center.
DR OVP; TM0159; Ortholog view popup.
DR TPM; TM0159; Target PDB monitor.
DR FSS; TM0159; Target function coverage.
PROPERTY Residues: 196 aa
Molecule Weight: 22336.72 Dalton
Isoelectric Point: 6.55
Extinction Coefficient: 14440
Gravy Index: -.35
Number of Met residues: 8
Percentage of Met residues: 4.08 %
Number of Cys residues: 1
Percentage of Cys residues: 0.51 %
SEQUENCE  amino acids 196 aa
>TM0159  TM0159 ham1 protein
MKKLTVYLATTNPHKVEEIKMIAPEWMEILPSPEKIEVVEDGETFLENSVKKAVVYGKKL
KHPVMADDSGLVIYSLGGFPGVMSARFMEEHSYKEKMRTILKMLEGKDRRAAFVCSATFF
DPVENTLISVEDRVEGRIANEIRGTGGFGYDPFFIPDGYDKTFGEIPHLKEKISHRSKAF
RKLFSVLEKILESENR

CDS  cDNA 588 bp
   1 atgaaaaaac tgaccgtcta ccttgcaacg acgaatccgc acaaagttga agaaataaag    60
  61 atgatcgctc cagaatggat ggagattctg ccctctcccg aaaaaatcga agtagtcgag   120
 121 gacggtgaaa cgtttctgga aaactccgtg aaaaaggccg tggtctacgg gaaaaaactc   180
 181 aaacatcctg tgatggcgga cgattccgga ctggtcatct attccctggg aggattcccc   240
 241 ggtgtcatgt ctgcccggtt catggaggaa cattcctaca aagagaagat gagaaccata   300
 301 ctgaagatgc ttgaaggaaa agatagaaga gctgctttcg tgtgcagtgc tacctttttc   360
 361 gatcctgtgg aaaacaccct tatttctgtt gaagacagag tagaaggccg aatagccaac   420
 421 gaaataagag ggacaggcgg tttcggatac gatccgttct tcataccgga tggatacgat   480
 481 aagaccttcg gcgaaattcc tcatctcaaa gaaaaaatca gtcacagatc aaaggccttc   540
 541 agaaagctct tttcggttct tgagaagatc ttagaatcag aaaaccgg   588
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
164902 165492 -1 Glimmer3 score - -
Genemark probabilities .87   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu