LOADING...
   TM0140;TM0140
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0140    TM0140            JCSG 282020 PDB Deposition 02-JUL-03              PDB id: 1j5t

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0140
DESCRIPTIONIndole-3-glycerol phosphate synthase (EC 4.1.1.48) (IGPS).
ORGANISMThermotoga maritima
COMMENT-!- CATALYTIC ACTIVITY: 1-(2-CARBOXYPHENYLAMINO)-1-DEOXY-D-RIBULOSE 5-
PHOSPHATE = 1-(INDOL-3-YL)GLYCEROL 3-PHOSPHATE + CO(2) + H(2)O.
-!- PATHWAY: TRYPTOPHAN BIOSYNTHESIS; FOURTH STEP.
-!- SIMILARITY: BELONGS TO THE TRPC FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT;
DR SPTR; Q56319 (flat text); Q56319 (good view)
DR GenBank; CAA63389
DR Pfam; PF00218; IGPS;
DR Interpro; IPR001468; IGPS;
DR PDB; 1J5T; Identical; 31-JUL-02; INDOLE-3-GLYCEROL PHOSPHATE SYNTHASE;
DR PDB; 1I4N; Identical; 20-MAR-02; INDOLE-3-GLYCEROL PHOSPHATE SYNTHASE;
DR PDB; 2C3Z; Highly similar; 13-OCT-05; INDOLE-3-GLYCEROL PHOSPHATE SYNTHASE;
DR PDB; 1IGS; Highly similar; 11-JUL-96; INDOLE-3-GLYCEROLPHOSPHATE SYNTHASE;
DR PDB; 1JUK; Highly similar; 07-JUL-97; INDOLE-3-GLYCEROL PHOSPHATE SYNTHASE;
DR PDB; 1JUL; Highly similar; 07-JUL-97; INDOLE-3-GLYCEROL PHOSPHATE SYNTHASE;
DR PDB; 1A53; Highly similar; 23-MAR-99; INDOLE-3-GLYCEROLPHOSPHATE SYNTHASE;
DR PDB; 1LBF; Highly similar; 12-JUN-02; INDOLE-3-GLYCEROL PHOSPHATE SYNTHASE;
DR KEGG; 4.1.1.48; Enzyme page
DR FFAS; 282020; Fold and function assignment.
DR TVPC; TM0140; Homologs in PDB, JCSG and SG center.
DR OVP; TM0140; Ortholog view popup.
DR TPM; TM0140; Target PDB monitor.
DR FSS; TM0140; Target function coverage.
PROPERTY Residues: 230 aa
Molecule Weight: 26008.62 Dalton
Isoelectric Point: 5.46
Extinction Coefficient: 16960
Gravy Index: -.11
Number of Met residues: 5
Percentage of Met residues: 2.17 %
Number of Cys residues: 1
Percentage of Cys residues: 0.43 %
SEQUENCE  amino acids 230 aa
>TM0140  TM0140 indole-3-glycerol phosphate synthase (trpC)
MIVQRRNHRFLEVLSGKERVKIIAEFKKASPSAGDINADASLEDFIRMYDELADAISILT
EKHYFKGDPAFVRAARNLTCRPILAKDFYIDTVQVKLASSVGADAILIIARILTAEQIKE
IYEAAEELGMDSLVEVHSREDLEKVFSVIRPKIIGINTRDLDTFEIKKNVLWELLPLVPD
DTVVVAESGIKDPRELKDLRGKVNAVLVGTSIMKAENPRRFLEEMRAWSE

CDS  cDNA 690 bp
   1 ttgatcgttc aaagaagaaa ccacagattt ctggaggttc tgtcgggaaa agagagagtg    60
  61 aagatcatag cggaattcaa gaaggcttct ccatctgctg gagatataaa cgctgatgct   120
 121 tctctggaag atttcataag gatgtacgac gagctggcgg atgcgatcag catcctcacg   180
 181 gaaaagcact atttcaaagg agatcctgcc ttcgtaagag cggcgagaaa cttgacctgc   240
 241 agacccattc tcgctaagga cttctatata gacacggtcc aggtgaaact ggcttccagt   300
 301 gtgggagcgg acgccatcct tataattgct cgaatactca ctgcagagca gataaaagag   360
 361 atctatgaag cggcggaaga gctcggaatg gacagtctcg tagaagtcca ctccagagaa   420
 421 gatctggaga aggtcttttc ggtgatcaga ccgaagataa tcggtatcaa cacgagagat   480
 481 ctggacactt tcgagataaa gaaaaatgtg ctgtgggaac ttctaccact cgtgccggat   540
 541 gatacggttg tggtcgctga aagtggcata aaagatccca gagaactcaa ggatctgcgg   600
 601 gggaaagtga acgctgttct cgttggtaca tccatcatga aagccgaaaa tccaagaaga   660
 661 tttctagaag agatgagagc atggtcagag   690
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
145311 146003 -3 Glimmer3 score 11.11 poor
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu