LOADING...
   TM0129;TM0129
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0129    TM0129            JCSG 282010 Refining 06-JUN-03

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0129
DESCRIPTIONCarboxypeptidase G2, putative.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WXY3_THEMA
DR SPTR; Q9WXY3 (flat text); Q9WXY3 (good view)
DR GenBank; AAD35223
DR Pfam; PF07687; M20_dimer;
DR Pfam; PF01546; Peptidase_M20;
DR Interpro; IPR002933; Peptidase_M20;
DR PDB; 1CG2; Highly similar; 24-DEC-97; CARBOXYPEPTIDASE G2;
DR FFAS; 282010; Fold and function assignment.
DR TVPC; TM0129; Homologs in PDB, JCSG and SG center.
DR OVP; TM0129; Ortholog view popup.
DR TPM; TM0129; Target PDB monitor.
DR FSS; TM0129; Target function coverage.
PROPERTY Residues: 358 aa
Molecule Weight: 39838.46 Dalton
Isoelectric Point: 5.41
Extinction Coefficient: 24410
Gravy Index: -.26
Number of Met residues: 7
Percentage of Met residues: 1.96 %
Number of Cys residues: 3
Percentage of Cys residues: 0.84 %
SEQUENCE  amino acids 358 aa
>TM0129  TM0129 carboxypeptidase G2, putative
MKWIEIYEKLVNIDTGPDLPLEGKLRRTSFLTEILEDLGFRVEKREAAYVAFRGKPPYVT
LIGHLDTVFPEGESKRRPFTIEGNIAKGPGVCDMKGGVVILLESLKRFLQQNDTDLCVVL
NVDEELGSPLSGEVFKEVAGMSSHCLSFEPGRENGELISSRKGIISLWLFARGKKGHASR
LDEGANAIVELAFKVVELTSLNGRFPNLTLNPTIVKGGAESNVTPDKAEVYFDVRYYDDK
EYEFLEETLKRLSAVHPEANVSYTLKLRRLPMKEDPDFVNIVKMSAEEIGMTVSFVRATG
GGDVAFFSQNGVPSIDGLGIPGGKMHSEDEYARLDQFEDRVNLVVHLLRKLGGEKNVR

CDS  cDNA 1074 bp
   1 atgaagtgga tcgaaattta cgaaaaactc gtgaacatcg acacaggacc cgatcttcca    60
  61 ttagagggga agctgaggcg aacgtcgttt ctgacagaaa tcctcgaaga ccttggtttc   120
 121 agagtggaaa aaagggaagc cgcttacgtg gccttccgtg gaaaaccgcc ttatgttacc   180
 181 ctcataggac atctcgacac cgtctttccc gaaggtgaat cgaagagaag acctttcaca   240
 241 atagaaggaa acatcgccaa gggtcctggt gtttgtgaca tgaaaggagg agttgtgatc   300
 301 cttcttgagt ctttgaaaag attcctccaa cagaacgaca ccgatctctg tgtggttcta   360
 361 aacgtggatg aagaactggg atcaccgctc agtggagaag tgttcaaaga agttgccggt   420
 421 atgagttccc actgtctatc cttcgagccg ggaagagaaa acggagagct catatcctcc   480
 481 aggaagggaa tcatctctct gtggttgttc gctcgcggaa aaaaaggaca cgcttcgaga   540
 541 ctggacgaag gagccaacgc gatcgttgaa ctggctttca aagtggtgga actaacttca   600
 601 ctgaacggga gatttccaaa ccttactctg aatccaacaa tcgtaaaggg cggtgcggaa   660
 661 agcaacgtaa caccggacaa agcagaggtt tatttcgatg tcaggtacta cgacgacaaa   720
 721 gagtacgagt ttctcgaaga aacactgaaa cgactctctg ctgtacatcc tgaagcgaac   780
 781 gtttcttaca ccttgaaact cagaaggctt cctatgaaag aagatcctga ttttgtgaac   840
 841 attgtgaaga tgtctgccga agagattgga atgactgtga gttttgtgag ggcaactggt   900
 901 ggaggagacg tggcgttttt ctcgcagaac ggcgttcctt ccatagacgg tctgggtatt   960
 961 cccggtggta agatgcactc cgaggatgaa tacgcgagac tcgatcaatt tgaagatagg  1020
1021 gtgaatctgg ttgtacatct tttgagaaaa cttggaggtg aaaaaaatgt tcgt  1074
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
135641 136717 -2 Glimmer3 score 13.38 good
Genemark probabilities .91   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu