LOADING...
   TM0123;TM0123
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0123    TM0123            JCSG 358399 Tracing 06-AUG-18

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0123
DESCRIPTIONPutative periplasmic metal-binding protein TM0123 precursor.
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: PART OF AN ATP-DRIVEN TRANSPORT SYSTEM
TM0123/TM0124/TM0125 FOR A METAL. METAL-BINDING COMPONENT.
-!- SUBCELLULAR LOCATION: PERIPLASMIC (POTENTIAL).
-!- SIMILARITY: BELONGS TO THE BACTERIAL SOLUTE-BINDING PROTEIN FAMILY
9.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; Y123_THEMA
DR SPTR; Q9WXX7 (flat text); Q9WXX7 (good view)
DR GenBank; AAD35217
DR Pfam; PF01297; TroA;
DR Interpro; IPR006128; Lipoprotein_4;
DR Interpro; IPR006127; SBP_bac_9;
DR FFAS; 282004; Fold and function assignment.
DR TVPC; TM0123; Homologs in PDB, JCSG and SG center.
DR OVP; TM0123; Ortholog view popup.
DR TPM; TM0123; Target PDB monitor.
DR FSS; TM0123; Target function coverage.
PROPERTY Residues: 267 aa
Molecule Weight: 30142.81 Dalton
Isoelectric Point: 6.25
Extinction Coefficient: 18910
Gravy Index: .16
Number of Met residues: 3
Percentage of Met residues: 1.12 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 267 aa
>TM0123  TM0123 zinc ABC transporter, periplasmic zinc-binding protein (znuA)
MKKILLLLVLIVAVLNFGKTIVTTINPYYLIVSQLLGDTASVKLLVPPGANPHLFSLKPS
DAKTLEEADLIVANGLGLEPYLEKYREKTVFVSDFIPALLLIDDNPHIWLDPFFLKYYIV
PGLYQVLIEKFPEKQSEIKQKAEEIVSGLDTVIRDSFKALLPYTGKTVVMAHPSFTYFFK
EFGLELITLSSGHEHSTSFSTIKEILRKKEQIVALFREPQQPAEILSSLEKELRMKSFVL
DPLGVNGEKTIVELLRKNLSVIQEALK

CDS  cDNA 801 bp
   1 atgaagaaga ttcttctcct tctagtactc attgtcgctg ttttgaattt cggcaaaact    60
  61 atcgtgacca cgataaaccc gtactatctc atcgtttctc agctacttgg tgatacagcg   120
 121 agcgtaaagc tccttgttcc ccctggagcg aatccacact tgttctcact aaagccttcc   180
 181 gacgctaaga ctctggaaga agcggatctg atcgtggcga acgggctcgg attggagccg   240
 241 tatttagaaa aatacagaga aaagacagtt ttcgtttcag acttcattcc agcacttctt   300
 301 ctcatcgatg ataaccctca catctggctc gatcctttct tcctcaaata ctacatcgtt   360
 361 cctggactgt accaggttct catcgagaaa ttcccagaaa aacagagcga aataaaacag   420
 421 aaagcagaag agatcgtaag cggattggac accgtgatca gagattcctt caaagcactc   480
 481 ctcccttaca ccggaaaaac ggtagtgatg gctcatccga gttttacgta cttcttcaag   540
 541 gaattcggcc tggaattgat aactctctcc agcggtcatg aacacagcac gagtttttcc   600
 601 acgatcaaag agatcctcag gaaaaaagaa cagattgttg ccctgttcag ggaaccgcag   660
 661 cagccggcag agattctctc gagcctcgaa aaagaactga gaatgaaaag cttcgtgctc   720
 721 gatcccctcg gagtgaacgg agaaaagacg atcgtggaac tcctgagaaa gaacctttct   780
 781 gtgatccagg aggcgttgaa a   801
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
130488 131291 3 Glimmer3 score 13.47 good
Genemark probabilities .89   .74 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu