LOADING...
   TM0119;TM0119
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0119    TM0119            JCSG 282000 PDB Deposition 05-NOV-23              PDB id: 2f4l

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0119
DESCRIPTIONAcetamidase, putative.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WXX3_THEMA
DR SPTR; Q9WXX3 (flat text); Q9WXX3 (good view)
DR GenBank; AAD35213
DR Pfam; PF03069; FmdA_AmdA;
DR Interpro; IPR004304; FmdA_AmdA;
DR PDB; 2F4L; Identical; 06-DEC-05; ACETAMIDASE, PUTATIVE;
DR PDB; 3TKK; Highly similar; 16-NOV-11; PREDICTED ACETAMIDASE/FORMAMIDASE;
DR PDB; 2II1; Highly similar; 05-DEC-06; ACETAMIDASE;
DR FFAS; 282000; Fold and function assignment.
DR TVPC; TM0119; Homologs in PDB, JCSG and SG center.
DR OVP; TM0119; Ortholog view popup.
DR TPM; TM0119; Target PDB monitor.
DR FSS; TM0119; Target function coverage.
PROPERTY Residues: 285 aa
Molecule Weight: 31194.41 Dalton
Isoelectric Point: 5.19
Extinction Coefficient: 28420
Gravy Index: .02
Number of Met residues: 7
Percentage of Met residues: 2.46 %
Number of Cys residues: 3
Percentage of Cys residues: 1.05 %
SEQUENCE  amino acids 285 aa
>TM0119  TM0119 acetamidase, putative
MKVVPAQRCVYSFSANMAPVEEVYPGEQVVFETLDALGGSYDKIDFSKVNPATGPVFVNG
VKPGDTLKVRIKRIELPRRGMIVTGKGFGVLGDEVEGFHTKELEIEKWAVLFDGVRIPIH
PMVGVIGVAPQEGEYPTGTAHRHGGNMDTKEITENVTVHLPVFQEGALLALGDVHATMGD
GEVCVSACEVPAKVVVEIDVSKEEIKWPVVETNDAYYIIVSLPDIEEALKEVTRETVWFI
QRRKTIPFTDAYMLASLSVDVGISQLVNPAKTAKARIPKYIFTGV

CDS  cDNA 855 bp
   1 atgaaggttg tgccagccca gaggtgtgta tactcgtttt cagcgaacat ggcacccgta    60
  61 gaagaggtat accctggtga acaggtcgtg ttcgaaacac tcgacgcact cggtggtagt   120
 121 tacgataaaa tcgatttttc gaaggtgaat ccagcgacgg gacctgtatt tgtcaacggt   180
 181 gtaaagcccg gagacacact gaaggttcgg ataaagagga tagaacttcc ccgaagagga   240
 241 atgatcgtaa ctggcaaggg attcggagtt ctcggtgacg aagtagaggg ttttcacaca   300
 301 aaagaactgg aaatagagaa atgggccgtt ctgttcgatg gtgtgaggat tccgattcac   360
 361 ccgatggtag gagtgatcgg ggttgctcct caggaaggcg agtacccaac gggaacggcc   420
 421 cacagacacg gaggaaacat ggacacgaaa gagataacag aaaacgtcac agtgcacctt   480
 481 ccagtgttcc aggaaggtgc acttcttgct ctgggagacg tccacgcgac gatgggagac   540
 541 ggagaagtgt gtgtctccgc gtgcgaagtc cctgcaaaag tggtcgtgga gatcgatgta   600
 601 tccaaagaag aaatcaaatg gcccgtggtt gagacaaacg atgcctacta catcatcgtt   660
 661 tctcttccag atatcgaaga ggctctgaaa gaagtcacac gcgaaacagt gtggtttatc   720
 721 cagaggcgga aaaccattcc cttcacagat gcctacatgc tcgccagtct ctccgtcgat   780
 781 gtgggtatct ctcagctcgt gaatcccgct aagactgcga aggctcgcat tccaaaatac   840
 841 atcttcacgg gggta   855
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
127340 128197 2 Glimmer3 score 10.7 poor
Genemark probabilities .88   .03 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu