LOADING...
   TM0077;TM0077
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0077    TM0077            JCSG 281958 PDB Deposition 10-MAR-17              PDB id: 3m81, 3m82, 3m83, 1vlq

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0077
DESCRIPTIONPutative acetyl xylan esterase.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WXT2_THEMA
DR SPTR; Q9WXT2 (flat text); Q9WXT2 (good view)
DR GenBank; AAD35171
DR Pfam; PF05448; AXE1;
DR Interpro; IPR008391; AXE1;
DR Interpro; IPR000379; Ser_estrs;
DR PDB; 1VLQ; Identical; 24-AUG-04; ACETYL XYLAN ESTERASE;
DR PDB; 3M81; Identical; 21-APR-10; ACETYL XYLAN ESTERASE;
DR PDB; 3M83; Identical; 12-MAY-10; ACETYL XYLAN ESTERASE;
DR PDB; 3M82; Identical; 26-MAY-10; ACETYL XYLAN ESTERASE;
DR PDB; 5FDF; Identical; 27-APR-16; CEPHALOSPORIN-C DEACETYLASE;
DR PDB; 3FVR; Highly similar; 05-JAN-10; ACETYL XYLAN ESTERASE;
DR PDB; 3FVT; Highly similar; 05-JAN-10; ACETYL XYLAN ESTERASE;
DR PDB; 3FYU; Highly similar; 26-JAN-10; ACETYL XYLAN ESTERASE;
DR KEGG; 3.1.1.72; Enzyme page
DR FFAS; 281958; Fold and function assignment.
DR TVPC; TM0077; Homologs in PDB, JCSG and SG center.
DR OVP; TM0077; Ortholog view popup.
DR TPM; TM0077; Target PDB monitor.
DR FSS; TM0077; Target function coverage.
PROPERTY Residues: 325 aa
Molecule Weight: 37154.48 Dalton
Isoelectric Point: 5.8
Extinction Coefficient: 55810
Gravy Index: -.33
Number of Met residues: 6
Percentage of Met residues: 1.85 %
Number of Cys residues: 5
Percentage of Cys residues: 1.54 %
SEQUENCE  amino acids 325 aa
>TM0077  TM0077 acetyl xylan esterase (axeA)
MAFFDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVT
FSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQ
GSGWLKGDTPDYPEGPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQE
RIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHR
DKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPY
NNHEGGGSFQAVEQVKFLKKLFEKG

CDS  cDNA 975 bp
   1 atggccttct tcgatttacc actcgaagaa ctgaagaaat atcgtccaga gcggtacgaa    60
  61 gagaaagact tcgatgagtt ctgggaagag acactcgcag agagcgaaaa gttcccctta   120
 121 gaccccgtct tcgagaggat ggagtctcac ctcaaaacag tcgaagcgta cgatgtcacc   180
 181 ttctccggat acaggggaca gaggatcaaa gggtggctcc ttgttccaaa actggaagaa   240
 241 gaaaaacttc cctgcgttgt gcagtacata ggatacaacg gtggaagagg attccctcac   300
 301 gactggctgt tctggccttc tatgggttac atatgtttcg tcatggatac tcgaggtcag   360
 361 ggaagcggct ggctgaaagg agacacaccg gattaccctg agggtcccgt tgaccctcag   420
 421 tatccaggat tcatgacaag aggaatactg gatcccagaa cttactacta cagacgagtc   480
 481 ttcacggacg ctgtcagagc cgttgaagct gctgcttctt ttcctcaggt agatcaagaa   540
 541 agaatcgtga tagctggagg cagtcagggt ggcggaatag cccttgcggt gagcgctctc   600
 601 tcaaagaaag caaaggctct tctgtgcgat gtgccgtttc tgtgtcactt cagaagagca   660
 661 gtacagcttg tggatacgca tccatacgcg gagatcacga actttctaaa gacccacaga   720
 721 gacaaggaag aaatcgtgtt caggactctt tcctatttcg atggagtgaa cttcgcagcc   780
 781 agagcgaaga tccctgcgct gttttctgtg ggtctcatgg acaacatttg tcctccttca   840
 841 acggttttcg ctgcctacaa ttactacgct ggaccgaagg aaatcagaat ctatccgtac   900
 901 aacaaccacg agggaggagg ctctttccaa gcggttgaac aggtgaaatt cttgaaaaaa   960
 961 ctatttgaga aaggc   975
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
80481 81458 3 Glimmer3 score 12.46 good
Genemark probabilities .93   .91 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu