LOADING...
   TM0067;TM0067
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0067    TM0067            JCSG 281948 PDB Deposition 05-JUL-25              PDB id: 2afb

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0067
DESCRIPTION2-dehydro-3- deoxygluconokinase (EC 2.7.1.45)
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WXS2_THEMA
DR SPTR; Q9WXS2 (flat text); Q9WXS2 (good view)
DR GenBank; AAD35161
DR Pfam; PF00294; PfkB;
DR Interpro; IPR002173; PfkB;
DR PDB; 2AFB; Identical; 14-FEB-06; 2-KETO-3-DEOXYGLUCONATE KINASE;
DR PDB; 4GM6; Highly similar; 26-SEP-12; PFKB FAMILY CARBOHYDRATE KINASE;
DR PDB; 3KTN; Highly similar; 15-DEC-09; CARBOHYDRATE KINASE, PFKB FAMILY;
DR PDB; 1V19; Highly similar; 14-APR-04; 2-KETO-3-DEOXYGLUCONATE KINASE;
DR PDB; 1V1A; Highly similar; 14-APR-04; 2-KETO-3-DEOXYGLUCONATE KINASE;
DR PDB; 1V1B; Highly similar; 14-APR-04; 2-KETO-3-DEOXYGLUCONATE KINASE;
DR PDB; 1V1S; Highly similar; 26-APR-04; 2-KETO-3-DEOXYGLUCONATE KINASE;
DR KEGG; 2.7.1.45; Enzyme page
DR FFAS; 281948; Fold and function assignment.
DR TVPC; TM0067; Homologs in PDB, JCSG and SG center.
DR OVP; TM0067; Ortholog view popup.
DR TPM; TM0067; Target PDB monitor.
DR FSS; TM0067; Target function coverage.
PROPERTY Residues: 339 aa
Molecule Weight: 37598.92 Dalton
Isoelectric Point: 5.89
Extinction Coefficient: 39880
Gravy Index: -.14
Number of Met residues: 7
Percentage of Met residues: 2.06 %
Number of Cys residues: 2
Percentage of Cys residues: 0.59 %
SEQUENCE  amino acids 339 aa
>TM0067  TM0067 2-keto-3-deoxygluconate kinase
MKVVTFGEIMLRLSPPDHKRIFQTDSFDVTYGGAEANVAAFLAQMGLDAYFVTKLPNNPL
GDAAAGHLRKFGVKTDYIARGGNRIGIYFLEIGASQRPSKVVYDRAHSAISEAKREDFDW
EKILDGARWFHFSGITPPLGKELPLILEDALKVANEKGVTVSCDLNYRARLWTKEEAQKV
MIPFMEYVDVLIANEEDIEKVLGISVEGLDLKTGKLNREAYAKIAEEVTRKYNFKTVGIT
LRESISATVNYWSVMVFENGQPHFSNRYEIHIVDRVGAGDSFAGALIYGSLMGFDSQKKA
EFAAAASCLKHTIPGDFVVLSIEEIEKLASGATSGRVER

CDS  cDNA 1017 bp
   1 atgaaggtgg taacttttgg agagatcatg ttgagactct caccaccaga tcataagagg    60
  61 atcttccaga cagacagctt cgacgtcacc tacggcggag cagaagcgaa cgtagcggct   120
 121 tttcttgctc agatgggact cgatgcgtac tttgtgacaa aactaccaaa caacccgctg   180
 181 ggggacgctg cagcaggaca tctcagaaag ttcggtgtga agacagacta catagcaaga   240
 241 ggtggaaatc gaataggtat ttacttcctt gagatagggg cttctcagag accgagtaaa   300
 301 gttgtctacg acagagcaca ctctgccatt tctgaggcaa aaagggaaga cttcgactgg   360
 361 gagaaaattt tggatggtgc gagatggttc cacttctcag gaattactcc tcctcttgga   420
 421 aaagaacttc ctctcatcct tgaagacgct ttgaaagtcg ctaatgaaaa aggtgtgacg   480
 481 gtgagctgtg atctaaatta cagagcaaga ctctggacaa aagaagaggc acagaaggtg   540
 541 atgattccat tcatggaata cgtggatgtt ctgatcgcaa acgaagaaga catagaaaaa   600
 601 gttcttggca tctcggttga aggtctcgat cttaagacag gaaaactgaa cagagaagcg   660
 661 tacgcgaaga tagcagaaga agtcactagg aaatacaact tcaagacggt tggtatcact   720
 721 ctcagagaaa gcatatccgc aactgtgaat tactggtccg tcatggtttt tgaaaatggt   780
 781 cagccccatt tctcgaacag atatgaaata catatcgtgg acagagtggg agccggagac   840
 841 agctttgcag gagctctcat ctacggaagt ttgatgggat ttgactcgca gaaaaaggcc   900
 901 gaattcgcgg cagccgcttc ctgtctcaag cacacaatac ccggggattt tgtggtgctc   960
 961 agcatagaag agatagagaa actcgcgtcc ggtgctacct ccggtcgagt ggaaaga  1017
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
67297 68316 1 Glimmer3 score 13 good
Genemark probabilities .97   .77 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu