LOADING...
   TM0066;TM0066
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0066    TM0066            JCSG 281947 PDB Deposition 04-AUG-18              PDB id: 1vlw

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0066
DESCRIPTION2-dehydro-3-deoxyphosphogluconate aldolase (EC 4.1.2.14) / 4-hydroxy-2-oxoglutarate aldolase (EC 4.1.3.16)
ORGANISMThermotoga maritima
COMMENTAnnotation updated by adding EC numbers.
Genome context: strongly supportive(clusterTM0064-TM0069 in one pathway. Functional context: strongly supportive(complete functional pathway in Pentose and glucuronate interconversion in KEGG).
DR UNIPROT; Q9WXS1_THEMA
DR SPTR; Q9WXS1 (flat text); Q9WXS1 (good view)
DR GenBank; AAD35160
DR Pfam; PF01081; Aldolase;
DR Interpro; IPR000887; Aldlse_KDPG_KHG;
DR PDB; 1WA3; Identical; 26-JAN-05; 2-KETO-3-DEOXY-6-PHOSPHOGLUCONATE ALDOLASE;
DR PDB; 1VLW; Identical; 24-AUG-04; 2-DEHYDRO-3-DEOXYPHOSPHOGLUCONATE ALDOLASE/4- HYDROXY-2-OXOG;
DR PDB; 2V81; Highly similar; 14-AUG-07; 2-DEHYDRO-3-DEOXY-6-PHOSPHOGALACTONATE ALDOLASE;
DR PDB; 2V82; Highly similar; 14-AUG-07; 2-DEHYDRO-3-DEOXY-6-PHOSPHOGALACTONATE ALDOLASE;
DR PDB; 3VCR; Highly similar; 18-JAN-12; PUTATIVE KDPG (2-KETO-3-DEOXY-6-PHOSPHOGLUCONATE) CHAIN: A,;
DR PDB; 4QCC; Highly similar; 19-NOV-14; 2-DEHYDRO-3-DEOXY-6-PHOSPHOGALACTONATE ALDOLASE, PROLYL CIS-;
DR PDB; 2YW3; Highly similar; 23-OCT-07; 4-HYDROXY-2-OXOGLUTARATE ALDOLASE/2-DEYDRO-3- DEOXYPHOSPHOGL;
DR PDB; 2YW4; Highly similar; 23-OCT-07; 4-HYDROXY-2-OXOGLUTARATE ALDOLASE/2-DEYDRO-3- DEOXYPHOSPHOGL;
DR KEGG; 4.1.2.14/4.1.3.16; Enzyme page
DR FFAS; 281947; Fold and function assignment.
DR TVPC; TM0066; Homologs in PDB, JCSG and SG center.
DR OVP; TM0066; Ortholog view popup.
DR TPM; TM0066; Target PDB monitor.
DR FSS; TM0066; Target function coverage.
PROPERTY Residues: 205 aa
Molecule Weight: 22235.01 Dalton
Isoelectric Point: 6.92
Extinction Coefficient: 6990
Gravy Index: .1
Number of Met residues: 6
Percentage of Met residues: 2.93 %
Number of Cys residues: 4
Percentage of Cys residues: 1.95 %
SEQUENCE  amino acids 205 aa
>TM0066  TM0066 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
MKMEELFKKHKIVAVLRANSVEEAKEKALAVFEGGVHLIEITFTVPDADTVIKELSFLKE
KGAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKA
MKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFKAGVLAVGVGSA
LVKGTPDEVREKAKAFVEKIRGCTE

CDS  cDNA 615 bp
   1 atgaagatgg aagagctctt caaaaaacac aagattgtag ccgtgctgag ggcaaacagt    60
  61 gtggaagaag cgaaagaaaa ggcgttggct gtttttgaag gaggagttca cctcatcgaa   120
 121 atcaccttca ctgttccaga cgctgacaca gtcatcaaag aactctcgtt cctcaaggaa   180
 181 aaaggtgcca taataggtgc aggtacagtg acgagtgtcg aacagtgcag aaaagctgta   240
 241 gaaagtggag cagagttcat cgtcagtcca caccttgacg aggaaatctc tcaattctgc   300
 301 aaagaaaaag gtgtcttcta catgcccggt gtgatgacac ccaccgaact tgtaaaagcc   360
 361 atgaaactcg gtcacacgat tttgaaactc ttccctggag aagtggtggg acctcagttt   420
 421 gtaaaagcga tgaaaggacc gttccccaat gtgaaattcg tgcccactgg aggcgtgaat   480
 481 ctggacaacg tgtgtgagtg gttcaaagcc ggagtcctcg ctgttggtgt tggaagtgcg   540
 541 cttgtgaaag gaacaccaga cgaggtgaga gaaaaagcaa aagcgttcgt agaaaagatc   600
 601 agggggtgca cagaa   615
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
66683 67300 2 Glimmer3 score - -
Genemark probabilities .85   .91 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu