LOADING...
   TM0064;TM0064
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0064    TM0064            JCSG 281945 PDB Deposition 02-JUL-02              PDB id: 1j5s

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0064
DESCRIPTIONUronate isomerase (EC 5.3.1.12) (Glucuronate isomerase) (Uronic isomerase).
ORGANISMThermotoga maritima
COMMENT-!- CATALYTIC ACTIVITY: D-GLUCURONATE = D-FRUCTURONATE.
-!- CATALYTIC ACTIVITY: D-GALACTURONATE = D-TAGATURONATE.
-!- PATHWAY: HEXURONATE CONVERSION TO KDG.
-!- SUBUNIT: HOMOTRIMER.
-!- SIMILARITY: BELONGS TO THE URONATE ISOMERASE FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; UXAC_THEMA
DR SPTR; Q9WXR9 (flat text); Q9WXR9 (good view)
DR GenBank; AAD35158
DR Pfam; PF02614; UxaC;
DR Interpro; IPR003766; UxaC;
DR PDB; 1J5S; Identical; 17-JUL-02; URONATE ISOMERASE;
DR PDB; 3IAC; Highly similar; 21-JUL-09; GLUCURONATE ISOMERASE;
DR KEGG; 5.3.1.12; Enzyme page
DR FFAS; 281945; Fold and function assignment.
DR TVPC; TM0064; Homologs in PDB, JCSG and SG center.
DR OVP; TM0064; Ortholog view popup.
DR TPM; TM0064; Target PDB monitor.
DR FSS; TM0064; Target function coverage.
PROPERTY Residues: 451 aa
Molecule Weight: 52303.03 Dalton
Isoelectric Point: 5.68
Extinction Coefficient: 95340
Gravy Index: -.45
Number of Met residues: 14
Percentage of Met residues: 3.10 %
Number of Cys residues: 3
Percentage of Cys residues: 0.67 %
SEQUENCE  amino acids 451 aa
>TM0064  TM0064 uronate isomerase, putative
MFLGEDYLLTNRAAVRLFNEVKDLPIVDPHNHLDAKDIVENKPWNDIWEVEGATDHYVWE
LMRRCGVSEEYITGSRSNKEKWLALAKVFPRFVGNPTYEWIHLDLWRRFNIKKVISEETA
EEIWEETKKKLPEMTPQKLLRDMKVEILCTTDDPVSTLEHHRKAKEAVEGVTILPTWRPD
RAMNVDKEGWREYVEKMGERYGEDTSTLDGFLNALWKSHEHFKEHGCVASDHALLEPSVY
YVDENRARAVHEKAFSGEKLTQDEINDYKAFMMVQFGKMNQETNWVTQLHIGALRDYRDS
LFKTLGPDSGGDISTNFLRIAEGLRYFLNEFDGKLKIVLYVLDPTHLPTISTIARAFPNV
YVGAPWWFNDSPFGMEMHLKYLASVDLLYNLAGMVTDSRKLLSFGSRTEMFRRVLSNVVG
EMVEKGQIPIKEARELVKHVSYDGPKALFFG

CDS  cDNA 1353 bp
   1 atgtttcttg gagaggatta ccttctgaca aacagagcag ctgtgcgatt gttcaatgag    60
  61 gtcaaggatc ttcccattgt ggatccacac aaccatctgg atgcgaaaga catcgttgag   120
 121 aacaaaccct ggaacgatat ctgggaagta gagggtgcga cagatcatta tgtgtgggaa   180
 181 ctcatgagac gctgtggtgt ttcggaagag tacataactg gatcgagaag taacaaagaa   240
 241 aaatggcttg ccctcgcaaa ggtgtttcca agatttgtgg gaaatccaac ctacgagtgg   300
 301 atacaccttg atctctggag aaggttcaac ataaagaagg taatttcaga agagacggca   360
 361 gaagagatat gggaagaaac gaaaaagaag cttcctgaga tgacacctca gaaacttctc   420
 421 agagacatga aggtggagat cctttgcaca acagatgatc ctgtttccac tctggaacat   480
 481 cacaggaagg caaaagaagc ggtggaaggt gttaccatcc ttcccacctg gagaccagac   540
 541 agagcaatga acgtagacaa agagggatgg agagagtacg tggagaagat gggggagcgt   600
 601 tacggtgaag acacctctac actcgatggt tttctgaacg cgctctggaa gtcacacgaa   660
 661 catttcaaag agcatggttg tgtggcgagt gaccatgctc tcctggagcc atcggtatac   720
 721 tatgtggacg aaaacagagc aagggcagtt catgaaaaag ccttcagtgg ggagaaactc   780
 781 actcaggatg aaataaacga ttacaaggcc tttatgatgg ttcagtttgg gaaaatgaac   840
 841 caggaaacga actgggtgac acagcttcac atcggtgctt tgagagatta tagagacagc   900
 901 cttttcaaaa cgctcggacc ggactcagga ggagatattt cgacgaactt tctgagaatc   960
 961 gcagaagggc tgaggtactt tctgaacgag ttcgacggaa agctcaagat cgttctctat  1020
1021 gtactcgatc ccacgcatct tccaacgata tccaccattg cacgtgcttt tccgaatgtt  1080
1081 tatgtcggtg ctccatggtg gttcaacgac agtccatttg gcatggagat gcacctgaaa  1140
1141 tacctcgctt cagtcgatct tctgtacaac cttgcgggaa tggtcacaga ttccagaaaa  1200
1201 cttctctcct tcggttccag aacagagatg ttcaggaggg ttctttcgaa tgtggtggga  1260
1261 gagatggttg aaaaggggca gattcctatt aaggaagcaa gagaactcgt gaagcacgtt  1320
1321 agttacgatg gcccgaaagc tctcttcttt gga  1353
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
64423 65778 -1 Glimmer3 score 12.88 good
Genemark probabilities .95   .98 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu