LOADING...
   TM0021;TM0021
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0021    TM0021            JCSG 281902 PDB Deposition 03-AUG-01              PDB id: 1o51

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0021
DESCRIPTIONPutative PII-like signaling protein [Ferredoxin-like]
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Y021_THEMA
DR SPTR; Q9WXM9 (flat text); Q9WXM9 (good view)
DR GenBank; AAD35115
DR Pfam; PF02641; DUF190;
DR Interpro; IPR003793; DUF190;
DR PDB; 1O51; Identical; 19-AUG-03; HYPOTHETICAL PROTEIN TM0021;
DR PDB; 2DCL; Highly similar; 08-JUL-06; HYPOTHETICAL UPF0166 PROTEIN PH1503;
DR FFAS; 281902; Fold and function assignment.
DR TVPC; TM0021; Homologs in PDB, JCSG and SG center.
DR OVP; TM0021; Ortholog view popup.
DR TPM; TM0021; Target PDB monitor.
DR FSS; TM0021; Target function coverage.
PROPERTY Residues: 102 aa
Molecule Weight: 11803.24 Dalton
Isoelectric Point: 6.41
Extinction Coefficient: 5960
Gravy Index: -.13
Number of Met residues: 5
Percentage of Met residues: 4.90 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 102 aa
>TM0021  TM0021 conserved hypothetical protein
MKLLKIYLGEKDKHSGKPLFEYLVKRAYELGMKGVTVYRGIMGFGHKRHMHRSDFFSLSP
DLPIVLEIVDEEERINLFLKEIDNIDFDGLVFTADVNVVKMG

CDS  cDNA 306 bp
   1 atgaagcttc tcaagatcta cctcggagaa aaagacaagc acagcggaaa gcctcttttc    60
  61 gagtatcttg tgaagcgcgc ttacgaactc ggtatgaaag gagtcaccgt ctacagaggt   120
 121 atcatgggtt tcggtcacaa gagacacatg cacagaagtg attttttcag tctttcaccg   180
 181 gatcttccta tcgttcttga gatcgtcgat gaagaagaga gaataaacct ttttttgaag   240
 241 gaaatcgaca acatagactt cgatggcctg gttttcaccg ctgacgtcaa cgtggtgaaa   300
 301 atgggt   306
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
17494 17802 1 Glimmer3 score 16.86 good
Genemark probabilities .84   .97 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu