LOADING...
   TM0015;TM0015
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0015    TM0015            JCSG 281896 PDB Deposition 07-SEP-14              PDB id: 2raa

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0015
DESCRIPTIONPyruvate synthase subunit PORC (EC 1.2.7.1) (Pyruvate oxidoreductase gamma chain) (POR) (Pyruvic-ferredoxin oxidoreductase gamma subunit).
ORGANISMThermotoga maritima
COMMENT-!- CATALYTIC ACTIVITY: PYRUVATE + COA + OXIDIZED FERREDOXIN = ACETYL-
COA + CO(2) + REDUCED FERREDOXIN.
-!- SUBUNIT: HETEROTETRAMER OF ONE ALPHA, ONE BETA, ONE DELTA AND ONE
GAMMA CHAIN.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; PORC_THEMA
DR SPTR; O05650 (flat text); O05650 (good view)
DR GenBank; CAA59455
DR Pfam; PF01558; POR;
DR Interpro; IPR002869; POR;
DR PDB; 2RAA; Identical; 02-OCT-07; PYRUVATE SYNTHASE SUBUNIT PORC;
DR KEGG; 1.2.7.1; Enzyme page
DR FFAS; 281896; Fold and function assignment.
DR TVPC; TM0015; Homologs in PDB, JCSG and SG center.
DR OVP; TM0015; Ortholog view popup.
DR TPM; TM0015; Target PDB monitor.
DR FSS; TM0015; Target function coverage.
PROPERTY Residues: 192 aa
Molecule Weight: 21268.52 Dalton
Isoelectric Point: 8.47
Extinction Coefficient: 12950
Gravy Index: -.19
Number of Met residues: 5
Percentage of Met residues: 2.60 %
Number of Cys residues: 2
Percentage of Cys residues: 1.04 %
SEQUENCE  amino acids 192 aa
>TM0015  TM0015 pyruvate ferredoxin oxidoreductase, gamma subunit (porG)
MPVAKKYFEIRWHGRAGQGAKSASQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIG
DEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKIC
VVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRA
LRRGYEEVKCSE

CDS  cDNA 576 bp
   1 atgcccgttg cgaagaaata ctttgaaata cgatggcacg gtagagccgg gcaaggtgcg    60
  61 aagagtgctt cccagatgct ggcagaagcc gctctggaag ccgggaaata cgttcaggct   120
 121 tttccagaat acggtgcaga aagaacaggt gctcccatga gggccttcaa caggattggt   180
 181 gacgagtaca tcagagtgag atctgcagtg gaaaacccgg acgtcgttgt ggtgatcgat   240
 241 gaaacactac tttctcccgc cattgtagaa ggcctttcag aagatggtat cctccttgtg   300
 301 aacaccgtta aggatttcga attcgtcaga aaaaagacag gattcaacgg aaagatatgc   360
 361 gtggtggatg ctacagacat cgctctccag gagataaaga gaggaatacc gaacacaccg   420
 421 atgcttggag cgctggtcag agtgacaggt attgtgcctc tcgaggcgat agagaagaga   480
 481 atcgagaaga tgttcggaaa gaaattccct caggaagtga ttgatgcgaa caagagagct   540
 541 ttgagacgtg gatatgagga agtaaagtgc tcagag   576
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
13245 13823 3 Glimmer3 score 12.36 good
Genemark probabilities .83   .82 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu