LOADING...
   TFUS_04MAR05_CONTIG93_REVISED_GENE761;FP2858A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TFUS_04MAR05_CONTIG93_REVISED_GENE761    FP2858A            JCSG 390257 PDB Deposition 08-JUN-03              PDB id: 3dcf

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTFUS_04MAR05_CONTIG93_REVISED_GENE761
DESCRIPTIONPutative transcriptional regulator of the TetR/AcrR family is similar to C-terminal region (inducing compounds-binding) of QacR.
ORGANISMThermobifida fusca yx-er1
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00440; TetR_N;
DR PDB; 3DCF; Identical; 15-JUL-08; TRANSCRIPTIONAL REGULATOR OF THE TETR/ACRR FAMILY;
DR PDB; 3VPR; Highly similar; 11-JUL-12; TRANSCRIPTIONAL REGULATOR, TETR FAMILY;
DR PDB; 2HYT; Highly similar; 15-AUG-06; TETR-FAMILY TRANSCRIPTIONAL REGULATOR;
DR FFAS; 383496; Fold and function assignment.
DR TVPC; TFUS_04MAR05_CONTIG93_REVISED_GENE761; Homologs in PDB, JCSG and SG center.
DR OVP; TFUS_04MAR05_CONTIG93_REVISED_GENE761; Ortholog view popup.
DR TPM; TFUS_04MAR05_CONTIG93_REVISED_GENE761; Target PDB monitor.
DR FSS; TFUS_04MAR05_CONTIG93_REVISED_GENE761; Target function coverage.
PROPERTY Residues: 217 aa
Molecule Weight: 24765.52 Dalton
Isoelectric Point: 6.03
Extinction Coefficient: 27390
Gravy Index: -.53
Number of Met residues: 3
Percentage of Met residues: 1.38 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 217 aa
>TFUS_04MAR05_CONTIG93_REVISED_GENE761  tfus_04mar05_Contig93_revised_gene761
VGQRSDSDHVMAEATTDKRQGHTRGRTGNDRRTQIIKVATELFREKGYYATSLDDIADRI
GFTKPAIYYYFKSKEDVLFAIVNSIVDEALERFHAIAAGPGSPGERIHALLVEHTRTILR
NLDANTVFYNERGLLSPEREREMRKREREYTEIMQRLYAEGVATGELLDVDPTVATATLL
GAAIWTYRWYDPEGRLSADEVVEQITRLLLNGYRRPA

CDS  cDNA 654 bp
   1 gtgggacaac gatccgattc ggaccatgtg atggctgagg caacaacaga caaacggcag    60
  61 ggccacaccc ggggacggac cggcaacgat cggcgtaccc agatcatcaa ggtcgccacc   120
 121 gaactcttcc gcgaaaaggg ctactacgcc acgtccctgg acgacattgc ggaccgcatc   180
 181 ggattcacca aaccggccat ctactactac ttcaaaagca aagaagacgt gctgttcgcg   240
 241 atcgtgaaca gcatcgtgga cgaggccctg gaacgattcc acgccattgc ggccggtccc   300
 301 ggcagccctg gggaacgcat ccacgccctc ctcgttgagc acacccgcac catcctgcgg   360
 361 aacctcgacg ccaacacggt cttctacaac gagcgcggtc tcctctcccc cgaacgggaa   420
 421 cgggagatgc gcaaacggga acgcgaatac accgagatca tgcagcgcct ctacgccgaa   480
 481 ggcgtggcca ccggggaact gctcgacgtc gacccaaccg tcgccacggc gaccctgctc   540
 541 ggcgccgcga tctggacata ccgctggtac gaccccgaag gccgactctc cgccgacgaa   600
 601 gtcgtcgaac agatcacgcg gctgctcctc aacggctacc gccgccccgc ctga   654
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
3287519 3288172 -2 Glimmer3 score - -
Genemark probabilities .83   - poor
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu