LOADING...
   TFUS_04MAR05_CONTIG93_REVISED_GENE318;EK2269L
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TFUS_04MAR05_CONTIG93_REVISED_GENE318    EK2269L            JCSG 387095 PDB Deposition 08-NOV-10              PDB id: 3f7w

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTFUS_04MAR05_CONTIG93_REVISED_GENE318
DESCRIPTIONPutative fructosamine-3-kinase.
ORGANISMThermobifida fusca yx-er1
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF03881; Fructosamin_kin;
DR Pfam; PF01636; APH;
DR PDB; 3F7W; Identical; 25-NOV-08; PUTATIVE FRUCTOSAMINE-3-KINASE;
DR FFAS; 387095; Fold and function assignment.
DR TVPC; TFUS_04MAR05_CONTIG93_REVISED_GENE318; Homologs in PDB, JCSG and SG center.
DR OVP; TFUS_04MAR05_CONTIG93_REVISED_GENE318; Ortholog view popup.
DR TPM; TFUS_04MAR05_CONTIG93_REVISED_GENE318; Target PDB monitor.
DR FSS; TFUS_04MAR05_CONTIG93_REVISED_GENE318; Target function coverage.
PROPERTY Residues: 287 aa
Molecule Weight: 31518.86 Dalton
Isoelectric Point: 5.32
Extinction Coefficient: 59930
Gravy Index: -.18
Number of Met residues: 4
Percentage of Met residues: 1.39 %
Number of Cys residues: 1
Percentage of Cys residues: 0.35 %
SEQUENCE  amino acids 287 aa
>TFUS_04MAR05_CONTIG93_REVISED_GENE318  tfus_04mar05_Contig93_revised_gene318
VNSVAARVTELTGREVAAVAERGHSHRWHLYRVELADGTPLFVKALPDDAPALDGLFRAE
ALGLDWLGRSFGSPVPQVAGWDDRTLAMEWVDERPPTPEAAERFGHQLAAMHLAGAESFG
ATWDGYIGPLPMDNTPRSTWPEFYAEQRILPYLRRAADRGALTPGDVRLVEKVLDALDHL
AGDPEPPARIHGDLWNGNVLWQDDGAVVIDPAAHGGHREADLAMLALFGLPYLDRVRDAY
NEVAPLAEGWRARIPLHQLHPLLVHVCLFGAAYRTTLVDTARAALRA

CDS  cDNA 864 bp
   1 gtgaattccg tcgctgccag agtgaccgaa ctgaccggtc gcgaggttgc cgccgttgcc    60
  61 gagcgaggac acagccaccg gtggcatctc taccgcgtgg aactggctga cgggaccccg   120
 121 ctcttcgtca aagcgcttcc cgacgacgcc ccggcactgg acggactttt ccgtgccgag   180
 181 gcgctaggcc tggactggtt ggggcggtcg ttcggctccc cggtacccca ggtagcgggg   240
 241 tgggacgacc gcaccctcgc catggagtgg gtggacgagc ggccgcccac tcccgaagca   300
 301 gcggaacggt tcggccacca gctcgccgcg atgcacttgg cgggcgccga atccttcggt   360
 361 gccacctggg acggctacat cggcccgctg cccatggaca acaccccgcg ttcgacgtgg   420
 421 ccggagttct acgccgagca gcggatcctg ccctacttgc gccgcgccgc cgaccggggc   480
 481 gcgctcaccc cgggcgacgt ccgcctcgtg gagaaagtgc tcgacgcgct tgaccacctg   540
 541 gcgggcgacc cggaaccccc ggcgcggatc cacggcgacc tgtggaacgg caacgtgctg   600
 601 tggcaggacg acggcgcggt cgtcatcgac cccgcggccc acggtggcca ccgggaagca   660
 661 gacctcgcca tgctggcgct gttcggcctg ccctacctgg accgggtccg cgacgcctac   720
 721 aacgaggtcg cgccgctcgc cgagggctgg cgggcccgga ttccgctgca ccagttgcat   780
 781 ccgctgctgg tgcacgtgtg cctgttcggg gcggcctacc gcaccacact ggtggacacg   840
 841 gctcgcgccg cgctccgcgc ctga   864
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2755331 2756194 -2 Glimmer3 score 13.72 good
Genemark probabilities .88   .07 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu