LOADING...
   TFUS_04MAR05_CONTIG93_REVISED_GENE2109;SF20744C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TFUS_04MAR05_CONTIG93_REVISED_GENE2109    SF20744C            JCSG 423184 PDB Deposition 12-MAR-15              PDB id: 4e6e

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTFUS_04MAR05_CONTIG93_REVISED_GENE2109
DESCRIPTIONPutative cell division protein FtsZ, cell division protein, tubulin homolog, GTP-binding, cell cycle, two domains
protein: Tubulin/FtsZ family domain and FtsZ family, C-terminal domain
ORGANISMThermobifida fusca yx-er1
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00091; Tubulin;
DR Pfam; PF03953; Tubulin_C;
DR PDB; 4E6E; Identical; 06-JUN-12; CELL DIVISION PROTEIN FTSZ;
DR PDB; 2Q1X; Highly similar; 06-MAY-08; CELL DIVISION PROTEIN FTSZ;
DR PDB; 2Q1Y; Highly similar; 06-MAY-08; CELL DIVISION PROTEIN FTSZ;
DR PDB; 1RLU; Highly similar; 31-AUG-04; CELL DIVISION PROTEIN FTSZ;
DR PDB; 1RQ2; Highly similar; 31-AUG-04; CELL DIVISION PROTEIN FTSZ;
DR PDB; 1RQ7; Highly similar; 31-AUG-04; CELL DIVISION PROTEIN FTSZ;
DR PDB; 4KWE; Highly similar; 31-JUL-13; CELL DIVISION PROTEIN FTSZ;
DR PDB; 2VAM; Highly similar; 11-SEP-07; CELL DIVISION PROTEIN FTSZ;
DR FFAS; 423183; Fold and function assignment.
DR TVPC; TFUS_04MAR05_CONTIG93_REVISED_GENE2109; Homologs in PDB, JCSG and SG center.
DR OVP; TFUS_04MAR05_CONTIG93_REVISED_GENE2109; Ortholog view popup.
DR TPM; TFUS_04MAR05_CONTIG93_REVISED_GENE2109; Target PDB monitor.
DR FSS; TFUS_04MAR05_CONTIG93_REVISED_GENE2109; Target function coverage.
PROPERTY Residues: 535 aa
Molecule Weight: 55434.8 Dalton
Isoelectric Point: 5.02
Extinction Coefficient: 5960
Gravy Index: -.28
Number of Met residues: 9
Percentage of Met residues: 1.68 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 535 aa
>TFUS_04MAR05_CONTIG93_REVISED_GENE2109  tfus_04mar05_Contig93_revised_gene2109
MVRAGRGRARTVHAPPGHLPGGARNHEASRTGQLSRRTGSGRDVPHGRSSRRGGAAGKKR
AERPLVVAAPQNYLAVIKVVGIGGGGVNAVNRMIEEGLKGVEFIAINTDAQALLMSDADV
KLDVGRELTRGLGAGANPDVGRKAAEDHREEIEEVLKGADMVFVTAGEGGGTGTGGAPVV
ANIARSLGALTIGVVTRPFSFEGKRRATQAEAGIAMLREEVDTLIVIPNDRLLSISDRQV
SVLDAFKAADQVLLSGVQGITDLITTPGLINLDFADVKSVMSGAGSALMGIGSARGDDRA
VAAAEMAISSPLLEASIDGAHGVLLSIQGGSDLGLFEINEAAQLVANSAAAEANIIFGAV
IDDALGDEVRVTVIAAGFDEPQVESPSPTPSRAVSAPTTPAAPERFTPPPPPPPPLRTVE
PPRSEPPTPSLARDPRPTTEPDSGAETAAEPAATEEPQSDSAAASEAKETKDTPANRDED
RPYRPGGLYPMGGEGGYTRPRVSDSPFSRSGEIPTPRRRVVFDEGDDLDVPDFLK

CDS  cDNA 1608 bp
   1 atggtgcggg cgggacgtgg acgtgcccgc acggtccatg ccccacccgg gcatctcccc    60
  61 ggaggcgccc ggaaccacga agcaagcaga accggacagc tttcgcgccg aaccggttcc   120
 121 gggagggacg tcccccacgg ccgatcctcc cggaggggcg gcgcggctgg caagaagcga   180
 181 gcggaaaggc ccctcgtcgt ggcagcaccg cagaactacc tcgcggtcat caaagtcgtc   240
 241 gggatcggcg gcggcggtgt caacgccgtc aatcgcatga tcgaagaggg tctcaagggc   300
 301 gtcgaattca tcgccatcaa caccgacgct caggcgctgc tcatgagcga cgccgacgtg   360
 361 aaactggacg tcggccgtga acttactcga ggtttgggag cgggcgccaa ccccgatgtg   420
 421 gggcgtaagg cggctgagga ccaccgcgaa gagatcgaag aggtcctcaa gggcgccgac   480
 481 atggtcttcg tgaccgccgg tgagggagga ggcaccggca cgggcggcgc cccggtagtc   540
 541 gccaacatcg ctcgctccct tggagcgctc accatcggtg tcgtcacccg cccgttcagt   600
 601 ttcgaaggca aacggcgcgc cacccaggct gaggcgggga tcgcgatgct gcgtgaggaa   660
 661 gtagacacgc tcatcgtcat ccccaacgac cgcctcctgt cgatctcgga ccggcaggtg   720
 721 agcgtcctcg acgccttcaa agccgccgac caggtgctgc tgtcgggtgt gcaaggcatc   780
 781 accgacctga tcaccacccc cgggctgatc aacctggact tcgccgacgt caagtcggtc   840
 841 atgtccgggg cgggctcggc tctcatgggg atcggatcgg cacgcggaga cgaccgcgcg   900
 901 gtcgcagcag ccgagatggc gatctcctcg ccgctgctgg aagccagcat cgacggcgcc   960
 961 cacggagtgc tgctgtcgat ccaaggcggt tccgacctcg gcctgttcga gatcaacgag  1020
1021 gcagcacagc tcgtcgccaa ctccgcggcc gcggaggcga acatcatctt cggtgcggtc  1080
1081 atcgacgacg cgctcggcga cgaagtgcgg gtcacggtta tcgccgccgg gttcgacgaa  1140
1141 ccccaggtgg agtcgccatc ccccaccccc tcccgtgcgg tcagcgcacc gaccacgccc  1200
1201 gcggcgccag agcggttcac cccgccaccg cctcctccgc cgccgctgcg tactgtggag  1260
1261 ccgccccgct ccgaaccgcc gacgccgagc ctggcgcgcg acccccgtcc cacgacggaa  1320
1321 ccggacagcg gggctgagac ggcagcggaa ccggccgcaa cagaggaacc gcagtcggac  1380
1381 agcgcggcag ccagcgaggc caaggagacc aaggacacgc cggcgaatcg ggacgaagac  1440
1441 cggccctacc ggcccggagg cctctacccc atgggagggg agggcgggta cacccgtccc  1500
1501 cgggtctccg acagcccgtt ctcccgcagc ggtgagatcc ccacaccgcg acgccgcgtc  1560
1561 gtcttcgacg aaggcgacga cctcgacgtc cccgacttcc tcaaatag  1608
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1298556 1300163 3 Glimmer3 score - -
Genemark probabilities .76   - poor
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu