LOADING...
   SYN_PCC7942_21JUN05_CONTIG52_REVISED_GENESYN_PCC79421565;FL11270A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
SYN_PCC7942_21JUN05_CONTIG52_REVISED_GENESYN_PCC79421565    FL11270A            JCSG 376411 Tracing 07-AUG-29

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONSYN_PCC7942_21JUN05_CONTIG52_REVISED_GENESYN_PCC79421565
DESCRIPTIONsyn_PCC7942_21jun05_Contig52_revised_geneSyn_pcc79421565
ORGANISMSYNECHOCOCCUS SP. PCC 7942 (ELONGATUS)
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 376411; Fold and function assignment.
DR TVPC; SYN_PCC7942_21JUN05_CONTIG52_REVISED_GENESYN_PCC79421565; Homologs in PDB, JCSG and SG center.
DR OVP; SYN_PCC7942_21JUN05_CONTIG52_REVISED_GENESYN_PCC79421565; Ortholog view popup.
DR TPM; SYN_PCC7942_21JUN05_CONTIG52_REVISED_GENESYN_PCC79421565; Target PDB monitor.
DR FSS; SYN_PCC7942_21JUN05_CONTIG52_REVISED_GENESYN_PCC79421565; Target function coverage.
PROPERTY Residues: 146 aa
Molecule Weight: 16151.66 Dalton
Isoelectric Point: 5.09
Extinction Coefficient: 13980
Gravy Index: -.06
Number of Met residues: 3
Percentage of Met residues: 2.05 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 146 aa
>SYN_PCC7942_21JUN05_CONTIG52_REVISED_GENESYN_PCC79421565  syn_PCC7942_21jun05_Contig52_revised_geneSyn_pcc79421565
VNATQRKLLMQLVIGAAWVDGDLDQPERQYLQTLLERQKLDHDPDLLVLLETPIGLPQLE
AWLVTFLQGTSTPTRLAALATIANLLMADGVVNRSEHSLLDEIHSLMAQIPASRDEEEYR
QAAPGLVQGLSGLVRRALNGAKHLFQ

CDS  cDNA 441 bp
   1 gtgaatgcaa cccagcgcaa actgttgatg cagctcgtca ttggtgccgc ttgggtcgac    60
  61 ggggacctcg atcagccaga gcgacagtac ctgcaaactc ttctggagcg gcagaagctt   120
 121 gatcacgatc cagacttgct ggtactcctc gaaaccccaa tcggactgcc tcaactggaa   180
 181 gcttggcttg ttacctttct acaggggacc agcaccccaa cacgcttggc ggctctggcc   240
 241 acgatcgcca atctactgat ggccgacggc gttgttaatc gcagtgagca tagcctactg   300
 301 gatgaaatcc actcactgat ggcgcagatt cccgcaagtc gcgacgaaga agagtatcgg   360
 361 caagcggccc caggcttagt ccagggattg agtggtctcg tgcgccgcgc cctaaatgga   420
 421 gccaagcatc tctttcagtg a   441
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1622970 1623410 3 Glimmer3 score 9.22 poor
Genemark probabilities .81   .62 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu