YP_001337146.1;SP18574A |
Protein Sequence Comparative Analysis (PSCA) | |
![]() |
|
YP_001337146.1 SP18574A JCSG 418471 PDB Deposition 15-JAN-28 PDB id: 4xvv Protein Sequence Information ![]() ![]()
SEQUENCE amino acids 101 aa >YP_001337146.1 gi|152972000|ref|YP_001337146.1| hypothetical protein KPN_03484 [Klebsiella pneumoniae subsp. pneumo MNLPKALVLTVAATTFCLMTSPAFAVEETTPQNMTCQEFMDMNPKSMTPVAFWVVNRNTD FSGGDYVDWHEVETVSVPKMLQECHKNPAAKLGDLSAVIKK CDS cDNA 306 bp 1 atgaatttac ctaaagcact cgtattgacc gtggcggcta ccacattctg tctgatgacc 60 61 agcccggcgt tcgcggttga ggaaaccacg ccgcagaata tgacctgtca ggaatttatg 120 121 gatatgaacc caaaaagcat gaccccggtg gccttctggg tagtgaatcg caacaccgac 180 181 tttagcggcg gcgactatgt tgactggcat gaagttgaga ccgtttcggt accgaaaatg 240 241 ctgcaggagt gccacaagaa ccccgcagct aaacttggcg atctcagcgc ggtcatcaaa 300 301 aaataa 306Target constructs Download sequence in PIR or FASTA format Chemical properties of sequence with tag Notes The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951). Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function. |