LOADING...
   ZP_02071651.1;SP16880A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02071651.1    SP16880A            JCSG 417957 PDB Deposition 12-APR-05              PDB id: 4eiu

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02071651.1
DESCRIPTIONDUF3823 family protein, PF12866
ORGANISMBacteroides uniformis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4EIU; Identical; 30-MAY-12; UNCHARACTERIZED HYPOTHETICAL PROTEIN;
DR PDB; 4IYK; Highly similar; 20-FEB-13; UNCHARACTERIZED PROTEIN;
DR FFAS; 409465; Fold and function assignment.
DR TVPC; ZP_02071651.1; Homologs in PDB, JCSG and SG center.
DR OVP; SP16880A; Ortholog view popup.
DR TPM; ZP_02071651.1; Target PDB monitor.
DR FSS; ZP_02071651.1; Target function coverage.
PROPERTY Residues: 271 aa
Molecule Weight: 30743.04 Dalton
Isoelectric Point: 5.1
Extinction Coefficient: 42400
Gravy Index: -.42
Number of Met residues: 7
Percentage of Met residues: 2.58 %
Number of Cys residues: 2
Percentage of Cys residues: 0.74 %
SEQUENCE  amino acids 271 aa
>ZP_02071651.1  gi|160890648|ref|ZP_02071651.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492]
MKKTIFYSLFSALFMLTSCSMFEIDNYEEPSETIWGEVVDEATGKRVLTDQGSEGIRVRL
TELSWGDNVQHNPDFYCMMDGTFQNTKIFKGEYNVRIDGPFIPLVRENTDGTLLHDGSVN
TEISGTTKVKFEVQPFLNVEFVGNPQVSNGVIKAQVRVTRGVSDEVFREKIQPMGNWKDE
YLNVTDIQFFVSYSNTVGYRARDERWSSSINYEGKSFEGLLGKEVTIQSNGNVPSGRKVF
VRAAARINYDTPVGSGTRRWNYSEPMEVLIP

CDS  cDNA 816 bp
   1 atgaaaaaga caatattcta tagcttattc agcgccctgt tcatgttaac ctcgtgtagt    60
  61 atgttcgaaa tagacaacta tgaggaacct tccgagacta tctggggtga ggtggtagat   120
 121 gaagcgaccg gtaagcgtgt attgaccgac cagggcagtg agggcatccg tgtccgcctg   180
 181 accgaattga gttggggtga caatgtgcaa cacaacccgg atttttactg catgatggac   240
 241 ggtacattcc agaacacgaa aatcttcaag ggtgagtata atgtccgtat cgacggtccg   300
 301 ttcattccgt tagtacgtga gaatacagac ggtaccttgc ttcacgacgg ctctgtcaat   360
 361 actgaaatca gtggcacgac gaaagtgaag ttcgaggtgc agcccttcct gaacgtcgag   420
 421 tttgtgggca atccgcaggt gagcaacggt gtcatcaagg cacaagtacg cgtaacacgc   480
 481 ggcgtgtcgg atgaggtctt ccgtgagaaa atccagccga tgggcaattg gaaggacgaa   540
 541 tacttgaacg tgaccgacat ccaattcttc gtcagctact caaacacagt aggctaccgg   600
 601 gcacgcgacg agcgttggtc gagcagcatc aactatgaag gcaagagttt cgagggctta   660
 661 ttggggaagg aagttaccat ccagtcgaac ggtaacgtac cttcgggccg caaagtgttt   720
 721 gtacgcgctg ccgcacgtat taactacgac acacccgtag gtagcggtac acgccgttgg   780
 781 aactacagcg agccgatgga agtgcttatt ccgtag   816
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu