LOADING...
   RER070207000171;SP19374A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
RER070207000171    SP19374A            JCSG 419643 PDB Deposition 13-JUL-19              PDB id: 4lr4

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONRER070207000171
DESCRIPTIONCASP Target
Description Hidden
ORGANISMEubacterium rectale
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4LR4; Identical; 18-SEP-13; HYPOTHETICAL PROTEIN;
DR FFAS; 411137; Fold and function assignment.
DR TVPC; RER070207000171; Homologs in PDB, JCSG and SG center.
DR OVP; RER070207000171; Ortholog view popup.
DR TPM; RER070207000171; Target PDB monitor.
DR FSS; RER070207000171; Target function coverage.
PROPERTY Residues: 394 aa
Molecule Weight: 43445.49 Dalton
Isoelectric Point: 4.73
Extinction Coefficient: 76210
Gravy Index: -.35
Number of Met residues: 7
Percentage of Met residues: 1.78 %
Number of Cys residues: 6
Percentage of Cys residues: 1.52 %
SEQUENCE  amino acids 394 aa
>RER070207000171  REr070207000171
MKKRKIATILLAACLLLGNVSVANAASIDNGNKVHFNTEDNDTDLTLLQSKIATEEVTCD
FTDATNDGASAYADTRRVSNKYMWSASTMEYNFSDQKWTSNTEIFSTYAKTSEGFVMSGF
LLNPKGQSNYNSALREGYLNDSAYDENQGHYYQCVVSDEDCNNITFMLESNVNVFIFDND
INLIYRSSDEAGVTSYFDRYYSTTKTIAGTSNKVISLGLIDGNYYIVFKVKDATATTGYH
YGYYAGQPLPIAQTTTFSDLTHYTTIKWNRSSSSQSASTQTLTINCPSGSEDEYALTGVK
FSDKSKAFANNTYASSIDYYYTPATASYSKKLAQTGGWWSDLVDNNPPSGSIDGNYATSV
TVHWVSGISYVNASCTTMTQMTLDYLVPFGIIVG

CDS  cDNA 1185 bp
   1 atgaaaaaga gaaaaatagc aacaatatta ttggcagcat gtttgctgtt aggaaatgtc    60
  61 tcagtagcga atgcggcaag tattgataat ggcaataaag tacatttcaa tacagaagat   120
 121 aacgacacgg atttaacatt attacaatcg aaaattgcaa ccgaagaagt gacttgtgac   180
 181 tttacggatg caacaaatga tggagcaagt gcatatgcag atacaagaag ggtgtcaaat   240
 241 aaatatatgt ggagtgcaag cacgatggaa tataatttct ctgatcagaa atggacatcg   300
 301 aatacagaaa tttttagtac atatgcaaaa acatcagaag ggtttgtaat gtctggtttc   360
 361 ttactgaatc caaaaggtca gagcaactat aattcggcat taagagaggg gtatctgaat   420
 421 gattctgcat atgatgaaaa tcagggacat tattatcaat gtgttgtttc ggatgaggac   480
 481 tgtaataata ttacatttat gttagaatct aatgttaatg tatttatttt tgacaatgat   540
 541 ataaatttaa tatatcgttc atcggatgag gcgggagtta ccagttattt tgacagatat   600
 601 tattcaacaa ctaaaacgat tgcaggaacg tcgaataagg taattagttt aggtcttatt   660
 661 gatggaaatt attatattgt ttttaaggta aaagatgcaa cagcaactac cggttatcat   720
 721 tatggatatt atgctggaca accattgcca atagcacaaa caacaacctt ttcggatctt   780
 781 acacattata caacaataaa gtggaatcga agctcatcta gccaatcagc aagtacgcaa   840
 841 acattgacca ttaattgtcc tagtggaagt gaagatgagt atgcattgac aggtgtgaaa   900
 901 ttttcggata aatcaaaagc atttgctaat aatacatacg catcaagcat tgactattat   960
 961 tatacgccag caactgctag ttattcaaaa aaactagcac aaacaggtgg ttggtggagt  1020
1021 gacttggttg acaataatcc accatcagga tcaattgatg gaaactatgc aacatctgtt  1080
1081 acagtacatt gggtaagtgg tatttcttat gtaaatgcta gttgcactac aatgacacag  1140
1141 atgacattgg attatttagt tcctttcgga ataatagtgg gctaa  1185
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu