LOADING...
   NP_811807.1;PX15502A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_811807.1    PX15502A            JCSG 396207 PDB Deposition 09-NOV-23              PDB id: 3kst

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_811807.1
DESCRIPTIONEndo-1,4-beta-xylanase.
ORGANISMBacteroides thetaiotaomicron vpi-5482
COMMENT-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
DR UNIPROT; Q8A3Q9_BACTN
DR SPTR; Q8A3Q9 (flat text); Q8A3Q9 (good view)
DR GenBank; NP_811807
DR Pfam; PF04616; Glyco_hydro_43;
DR PDB; 3KST; Identical; 08-DEC-09; ENDO-1,4-BETA-XYLANASE;
DR PDB; 4QQS; Highly similar; 11-MAR-15; GLYCOSIDE HYDROLASE FAMILY 43;
DR PDB; 3QZ4; Highly similar; 06-APR-11; ENDO-1,4-BETA-XYLANASE D;
DR KEGG; 3.2.1.-; Enzyme page
DR FFAS; 395683; Fold and function assignment.
DR TVPC; NP_811807.1; Homologs in PDB, JCSG and SG center.
DR OVP; PX15502A; Ortholog view popup.
DR TPM; NP_811807.1; Target PDB monitor.
DR FSS; NP_811807.1; Target function coverage.
PROPERTY Residues: 330 aa
Molecule Weight: 36920.57 Dalton
Isoelectric Point: 5.07
Extinction Coefficient: 83770
Gravy Index: -.33
Number of Met residues: 5
Percentage of Met residues: 1.52 %
Number of Cys residues: 6
Percentage of Cys residues: 1.82 %
SEQUENCE  amino acids 330 aa
>NP_811807.1  gi|29348304|ref|NP_811807.1| endo-1,4-beta-xylanase [Bacteroides thetaiotaomicron VPI-5482]
MFKKEIYSLLLFSFGLLFTCCGESATDDEEKDNNGQGSVSVETNYLPIADPYVMFYNNKY
YAYGTGGTTAGEGFACFSSDDLKNWKREGQALSATDSYGTWGFWAPEVYYVESKKKFYLF
YSAEEHICVATSTTPEGPFRQEVKQPIWSEKSIDTSLFIDDDGTPYLYFVRFTDGNVIWV
AQMTDDLMSIKTETLNQCIKAEVSWELLQGKVAEGPSLLKKNGVYYLIYSANHYENKGYG
VGYATSDTPMGPWVKYSKNPLLQGDAATGLVGTGHGAPFQCKDGSWKYIFHAHWSAAEIQ
PRTSYIKDFAISDQGVVTISGTVIKPRVLK

CDS  cDNA 993 bp
   1 atgttcaaga aagaaatata tagtctattg ctattctcct ttgggctttt gtttacttgt    60
  61 tgtggagaga gtgcaacaga tgacgaggaa aaagataata atggtcaggg aagtgttagt   120
 121 gtggagacta attacctgcc tattgcagac ccctacgtga tgttctataa taataaatat   180
 181 tatgcttatg gtacaggagg aacaactgcc ggagaggggt ttgcctgctt ttcttctgac   240
 241 gatttgaaaa actggaaacg tgaggggcag gctctatctg caaccgattc ttatggtaca   300
 301 tggggttttt gggcaccgga ggtctattac gttgagtcta agaagaaatt ttatctgttc   360
 361 tattcagcag aagaacatat ttgcgtagcg acttctacta ctcctgaagg tccattccga   420
 421 caagaagtaa agcagccgat ctggagtgag aaaagcattg atacttcttt gtttatagat   480
 481 gatgacggta ctccatatct ttatttcgta cgttttacag atgggaatgt gatatgggtg   540
 541 gctcagatga ctgatgactt gatgagtata aagacagaga ctttgaatca atgtataaaa   600
 601 gctgaagtat catgggaact tttgcaaggt aaagtagcgg aaggaccttc tcttttgaaa   660
 661 aagaatggcg tgtattatct gatttattct gctaatcatt atgaaaataa aggatatgga   720
 721 gttggatatg caacctcaga tactcctatg gggccttggg tgaagtatag caagaatcca   780
 781 cttttacagg gtgatgcagc taccggctta gtaggtacag gacatggagc gccgttccaa   840
 841 tgcaaagatg gtagttggaa gtatatattt catgctcatt ggagtgctgc ggagatacaa   900
 901 cctcgaacat cgtatattaa ggattttgcc atttcggatc agggagtggt tactattagt   960
 961 ggaactgtaa ttaagccgag agttctgaag taa   993
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
3618732 3619724 -3 Glimmer3 score 5.8 poor
Genemark probabilities .79   .01 poor
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu