LOADING...
   NP_979294.1;MI1030N
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_979294.1    MI1030N            JCSG 399377 PDB Deposition 13-AUG-25              PDB id: 4me9

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_979294.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacillus cereus atcc 10987
COMMENT 
DR UNIPROT; Q736B0_BACC1
DR SPTR; Q736B0 (flat text); Q736B0 (good view)
DR GenBank; NP_979294
DR Pfam; PF00440; TetR_N;
DR PDB; 4ME9; Identical; 25-SEP-13; TRANSCRIPTIONAL REGULATOR, TETR FAMILY;
DR PDB; 3LWJ; Highly similar; 16-MAR-10; PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR;
DR FFAS; 399377; Fold and function assignment.
DR TVPC; NP_979294.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_979294.1; Ortholog view popup.
DR TPM; NP_979294.1; Target PDB monitor.
DR FSS; NP_979294.1; Target function coverage.
PROPERTY Residues: 188 aa
Molecule Weight: 21654.82 Dalton
Isoelectric Point: 5.06
Extinction Coefficient: 15930
Gravy Index: -.07
Number of Met residues: 6
Percentage of Met residues: 3.19 %
Number of Cys residues: 1
Percentage of Cys residues: 0.53 %
SEQUENCE  amino acids 188 aa
>NP_979294.1  gi|42782047|ref|NP_979294.1| transcriptional regulator, TetR family [Bacillus cereus ATCC 10987]
MAKNKQEDIFDAAMQLFAERGYDGTTIPMIAEKAKVGAGTIYRYFENKEALVNSLFSKSM
LQLSEMIKTDFPVEANIREQFSHTYNRLFEFARNNVDAFLFTNSHCDSYFLDEQSKKIFD
DFIGFFMNIIEDGIVKGLLRPLPPVALIIIVYQPLEKLIKVIATGQLEYSKELVKELEES
SWNAIRII

CDS  cDNA 567 bp
   1 atggctaaaa acaaacaaga ggatattttt gatgctgcga tgcaactttt tgcggagcgt    60
  61 ggttacgatg gtacgacaat tccaatgatc gctgaaaagg caaaagtcgg tgcgggtact   120
 121 atttatcgct attttgaaaa taaagaggcg cttgttaact cattattttc aaaaagtatg   180
 181 ttacagcttt ctgaaatgat aaaaacggat tttcctgttg aagcaaatat tcgtgaacag   240
 241 tttagtcata cgtataaccg tttatttgaa tttgcgagaa ataatgtgga tgcttttctg   300
 301 tttacaaatt ctcactgtga tagttatttt cttgatgaac aaagcaagaa aatatttgat   360
 361 gattttatag gcttctttat gaatattata gaagatggga ttgtaaaagg cttactccgt   420
 421 ccgttacctc cagttgcttt aattattatt gtatatcaac cgttagaaaa attaattaaa   480
 481 gtaattgcaa cagggcaatt agagtactca aaagaattag taaaagaatt ggaagaaagc   540
 541 tcttggaacg ctataagaat catttga   567
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2801989 2802555 -1 Glimmer3 score 9.92 poor
Genemark probabilities .81   .96 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu