LOADING...
   NP_976569.1;MH12279D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_976569.1    MH12279D            JCSG 394177 PDB Deposition 14-JUL-15              PDB id: 4qvu

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_976569.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacillus cereus atcc 10987
COMMENT 
DR UNIPROT; Q73EW7_BACC1
DR SPTR; Q73EW7 (flat text); Q73EW7 (good view)
DR GenBank; NP_976569
DR PDB; 4QVU; Identical; 06-AUG-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 394177; Fold and function assignment.
DR TVPC; NP_976569.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_976569.1; Ortholog view popup.
DR TPM; NP_976569.1; Target PDB monitor.
DR FSS; NP_976569.1; Target function coverage.
PROPERTY Residues: 264 aa
Molecule Weight: 30780.7 Dalton
Isoelectric Point: 5.93
Extinction Coefficient: 30370
Gravy Index: -.25
Number of Met residues: 4
Percentage of Met residues: 1.52 %
Number of Cys residues: 6
Percentage of Cys residues: 2.27 %
SEQUENCE  amino acids 264 aa
>NP_976569.1  gi|42779322|ref|NP_976569.1| hypothetical protein BCE0241 [Bacillus cereus ATCC 10987]
MDTQQLYFLNDIGKQKPESIRNRSAACPFCDRENLTDILATEGSIIWLKNKFPTLKDTFQ
TVLIETDNCEDHIATYTEEHMRSLIRFSIKHWLNLQKNEEFTSVILYKNHGPFSGGSLHH
AHMQIIGMKYVNYLDNVEQDNFQGVIVQKNEHIELNISDRPIIGFTEFNIIIEDIGCIDE
LANYIQQTVRYILTDFHKGCSSYNLFFYYLNEKIICKVVPRFVVSPLYVGYKIPQVSTKI
EDVKIQLAAYFTKQNDAIIHKKIE

CDS  cDNA 795 bp
   1 atggatacac aacaactata ctttttaaac gatatcggca aacaaaaacc agaaagcatc    60
  61 cggaatagaa gcgctgcatg tcctttttgt gacagagaaa atttaacgga tattttagca   120
 121 actgaaggct caattatttg gctaaaaaac aaatttccta cattaaaaga tacatttcaa   180
 181 acggtgctaa tcgaaacaga taattgtgaa gatcatattg cgacatatac agaagaacat   240
 241 atgcgatcgt taatccgttt ctccattaaa cattggttaa acttacagaa gaatgaagaa   300
 301 ttcacatctg taattttata caaaaatcat ggtccattct caggtggaag tttgcatcat   360
 361 gcacacatgc agattattgg aatgaaatat gtaaactacc tcgataacgt agaacaggac   420
 421 aatttccaag gagtaattgt acaaaagaac gaacacattg aactcaacat ttcagatcgt   480
 481 cccattatcg gttttactga atttaatatc attattgaag atattggatg catagatgaa   540
 541 ctagcaaatt atattcagca aactgtacgt tacatactga cagatttcca taaaggatgt   600
 601 agtagttata acttattctt ctattactta aacgaaaaaa tcatttgtaa agttgttcct   660
 661 agatttgtcg tttcaccgtt atatgtagga tataaaatac cgcaagtttc cacaaaaata   720
 721 gaagacgtaa aaatacaact agcagcgtat ttcacaaaac aaaacgacgc gattatccat   780
 781 aaaaaaatag agtag   795
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
244565 245359 -2 Glimmer3 score 4.54 poor
Genemark probabilities .76   .86 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu