LOADING...
   NP_953118.1;FP7307A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_953118.1    FP7307A            JCSG 383524 PDB Deposition 14-OCT-22              PDB id: 4rn3

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_953118.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMGeobacter sulfurreducens
COMMENT 
DR UNIPROT; Q74BH2_GEOSL
DR SPTR; Q74BH2 (flat text); Q74BH2 (good view)
DR GenBank; NP_953118
DR Pfam; PF00702; Hydrolase;
DR PDB; 4RN3; Identical; 26-NOV-14; HAD SUPERFAMILY HYDROLASE;
DR FFAS; 383524; Fold and function assignment.
DR TVPC; NP_953118.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_953118.1; Ortholog view popup.
DR TPM; NP_953118.1; Target PDB monitor.
DR FSS; NP_953118.1; Target function coverage.
PROPERTY Residues: 212 aa
Molecule Weight: 23775.07 Dalton
Isoelectric Point: 5.28
Extinction Coefficient: 15930
Gravy Index: -.06
Number of Met residues: 12
Percentage of Met residues: 5.66 %
Number of Cys residues: 3
Percentage of Cys residues: 1.42 %
SEQUENCE  amino acids 212 aa
>NP_953118.1  gi|39997167|ref|NP_953118.1| HAD-superfamily hydrolase, subfamily IA, variant 1 [Geobacter sulfurred
MAVSSNGGAIKAVIYDCDGVMFDSFEANLAFYQRIMEMMGRPRLSRDNEEQMRILHTYAN
REVLAHFFPSPGDWEEAVRCAGAIDYRELVPLMIMEEGFREALDTLKGRVGLGVCTNRST
SMDMVLRLFSLDSYFSIVMTASRVTNPKPHPEPLLKVLEHFGIGPREALFVGDSEVDRLS
AEAAGVPFVAYKAPLPAAYRMEHHREIIDLLG

CDS  cDNA 639 bp
   1 atggcggtga gcagtaacgg cggggccatc aaggcggtaa tctacgattg tgacggggtc    60
  61 atgttcgact cattcgaggc gaacctcgcg ttttaccagc ggatcatgga gatgatgggc   120
 121 cgcccccggc tcagcaggga taacgaggag cagatgcgca tcctccacac gtacgccaat   180
 181 cgggaggtgc tggcccattt cttcccgtca cccggcgact gggaggaggc ggtccggtgt   240
 241 gccggcgcca tcgactaccg ggaactggtc ccgctcatga tcatggagga gggattccgc   300
 301 gaggccctcg acaccctgaa ggggagggtg gggctcggtg tctgcaccaa ccggtcgacc   360
 361 tccatggaca tggtgctccg gttgttcagt ctcgactcct atttcagcat tgtcatgacc   420
 421 gcgtcacggg tgacgaaccc aaaaccccac ccggaacccc tgctgaaggt gctcgaacac   480
 481 ttcggcatcg gcccacggga ggccctgttc gtgggtgatt ccgaggtgga ccggttgtcg   540
 541 gccgaggctg ccggcgtccc cttcgtggcc tacaaggccc cgctccccgc cgcgtaccgg   600
 601 atggagcacc accgcgagat catagacctt ctcgggtga   639
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2271279 2271917 -3 Glimmer3 score 11.96 poor
Genemark probabilities .87   .98 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu