LOADING...
   NP_906188.1;C.KN20875A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_906188.1    C.KN20875A            JCSG 424993 PDB Deposition 14-APR-29              PDB id: 4q98

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_906188.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMPorphyromonas gingivalis w83
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF06321; P_gingi_FimA;
DR PDB; 4Q98; Identical; 04-JUN-14; MAJOR FIMBRIAL SUBUNIT PROTEIN;
DR FFAS; 424993; Fold and function assignment.
DR TVPC; NP_906188.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_906188.1; Ortholog view popup.
DR TPM; NP_906188.1; Target PDB monitor.
DR FSS; NP_906188.1; Target function coverage.
PROPERTY Residues: 388 aa
Molecule Weight: 41244.19 Dalton
Isoelectric Point: 5.26
Extinction Coefficient: 42290
Gravy Index: -.16
Number of Met residues: 5
Percentage of Met residues: 1.29 %
Number of Cys residues: 5
Percentage of Cys residues: 1.29 %
SEQUENCE  amino acids 388 aa
>NP_906188.1  gi|34541709|ref|NP_906188.1| fimbrilin [Porphyromonas gingivalis W83]
MKKTKFFLLGLAALAMTACNKDNEAEPVVETNATVSFIIKSGESRAVGDDLTDAKITKLT
AMVYAGQVQEGIKTVEEDGGVLKVEGIPCKSGANRVLVVVANHNYELTGKSLNEVEALTT
SLTAENQNAKNLIMTGKSAAFTIKPGSNHYGYPGGTASDNLVSAGTPLAVTRVHAGISFA
GVEVNMATQYQNYYSFKPADAKIAALVAKKDSKIFGNSLVSNTNAYLYGVQTPAGLYTPD
AAGETYELEASLNTNYAVGAGFYVLESKYDASNELRPTILCIYGKLLDKDGNPLTEPALT
DAINAGFCDGDGTTYYPVLVNYDGNGYIYSGAITQGQNKIVRNNHYKISLNITGPGTNTP
ENPQPVQANLNVTCQVTPWVVVNQAATW

CDS  cDNA 1167 bp
   1 atgaaaaaaa caaagttttt cttgttggga cttgctgctc ttgctatgac agcttgtaac    60
  61 aaagacaacg aggcagaacc cgttgtagaa actaacgcta ctgttagttt cataattaag   120
 121 agcggtgaga gccgcgctgt aggcgatgac cttacagatg ctaagatcac aaagctcacc   180
 181 gccatggtct atgcaggtca agttcaagaa ggtattaaga cagtggaaga ggacggcgga   240
 241 gtccttaaag tagaaggaat tccgtgtaaa tctggagcca accgtgtcct cgtcgttgta   300
 301 gccaatcaca attatgagct taccggtaaa agtttgaatg aggttgaggc cttgacgact   360
 361 tctttgacag ctgaaaacca aaatgccaaa aacttgatca tgacaggtaa gtcagcagct   420
 421 tttacaatca aaccgggctc caaccactat ggctatcctg gtgggactgc atccgacaac   480
 481 cttgtttctg ctggaactcc tcttgccgtt actcgcgtgc atgccggtat ctcattcgca   540
 541 ggagtagagg taaatatggc tacacagtat caaaactact attcttttaa accagctgac   600
 601 gctaaaatcg cagcccttgt cgcaaagaaa gattctaaga ttttcggcaa ttctttggtc   660
 661 tcaaacacta atgcatattt gtatggagtc caaacgcctg ccggtcttta cactccggat   720
 721 gctgcaggag aaacatacga attggaggcg tctttgaata cgaattatgc tgtaggtgcc   780
 781 ggcttctatg tgctggaaag taaatatgat gcaagcaacg agcttcgtcc gacgatcctt   840
 841 tgtatctatg gaaagctgct cgataaggac ggcaaccctc tcacggaacc agccttgacg   900
 901 gatgctataa atgccggatt ctgcgacgga gatggcacga cttactatcc ggtattggtg   960
 961 aactatgatg gcaatggcta catctattca ggtgctatta cccaaggaca aaacaaaatc  1020
1021 gttcgcaaca accactacaa gatttcgctg aacatcaccg gccccggtac gaatactcct  1080
1081 gaaaatcctc aaccggtaca agccaacctg aatgttactt gccaagttac accttgggtt  1140
1141 gttgttaatc aggctgctac ttggtaa  1167
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2237837 2239003 2 Glimmer3 score 5.53 poor
Genemark probabilities .63   .06 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu