LOADING...
   NP_904517.1;C.KN20883A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_904517.1    C.KN20883A            JCSG 425089 PDB Deposition 14-SEP-18              PDB id: 4rdb

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_904517.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMPorphyromonas gingivalis w83
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4RDB; Identical; 03-DEC-14; IMMUNOREACTIVE 32 KDA ANTIGEN PG49;
DR FFAS; 425088; Fold and function assignment.
DR TVPC; NP_904517.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_904517.1; Ortholog view popup.
DR TPM; NP_904517.1; Target PDB monitor.
DR FSS; NP_904517.1; Target function coverage.
PROPERTY Residues: 333 aa
Molecule Weight: 37137.17 Dalton
Isoelectric Point: 5.32
Extinction Coefficient: 53860
Gravy Index: -.27
Number of Met residues: 5
Percentage of Met residues: 1.50 %
Number of Cys residues: 1
Percentage of Cys residues: 0.30 %
SEQUENCE  amino acids 333 aa
>NP_904517.1  gi|34540038|ref|NP_904517.1| immunoreactive 32 kDa antigen PG49 [Porphyromonas gingivalis W83]
MKKYLLYASLLTSVLLFSCSKNNPNEPVEDRSIEISIRVDDFTKTGEAVRYERNQGSAAE
RLITNLYLLLFDQSGANPAKYYITGNTFTGGTWLPDDMKVKLDMTQSEAGERKVYVVANV
DNAVKTALDAVANESDLQTVKRTTAMPWSTDIASPFLMSGNKTHDFLANRLLDNVPLVRA
IAKVELNISLSEKFQIVPIIVNGSLSEFKFRYVNFDKETYVVKPTTKPDNLISSANGVWP
QITDWTVWGASLNTSPAPDAGTGYTLDANGKVTALRIVTYLNERDSKGATVEVALPRVDD
GTLPPPEFGPELYRLPLPDKILRNHWYKYEVEI

CDS  cDNA 1002 bp
   1 atgaaaaagt atttgttata tgcctcgttg ctaacgagtg ttttgctctt ttcctgttca    60
  61 aagaacaatc ctaacgagcc ggtggaagac agatccatcg aaatttctat aagggtagat   120
 121 gatttcacca aaacgggtga ggcagtacgc tatgaaagga atcaaggaag tgctgccgaa   180
 181 aggctcatta ccaatcttta cctcttgttg ttcgatcagt caggggcgaa tccggcgaaa   240
 241 tactatatta ccggtaacac tttcaccgga gggacctggc ttcctgacga tatgaaggtg   300
 301 aagttggata tgacacaatc cgaggccgga gagcgcaaag tatatgtcgt agccaatgtt   360
 361 gataatgcgg ttaaaacggc tcttgatgct gtcgctaacg aaagcgattt gcagactgta   420
 421 aagaggacga ctgcaatgcc gtggtcgacc gatatagcct ctcctttcct gatgtccgga   480
 481 aacaagacac acgacttctt ggccaatcgt cttttggaca atgtgcccct tgtgcgtgcc   540
 541 attgccaagg tggagctgaa tatctcgctg agtgagaaat ttcagattgt gccgataatt   600
 601 gtcaatggta gtttgagtga gttcaagttc agatacgtaa acttcgacaa ggagacctac   660
 661 gtagtgaagc caacgaccaa gccggacaat ctcattagtt ctgctaatgg tgtttggcct   720
 721 cagattacag attggactgt atggggtgct tccttaaata cttctcctgc tccggatgcg   780
 781 ggcacaggtt atacattgga tgcaaatggc aaggtaacgg cactacggat tgttacctat   840
 841 ctgaatgagc gcgatagcaa aggggctacg gtagaggtcg cattgcctcg tgtggatgat   900
 901 ggcacccttc ctcctccgga attcggtccg gagctttatc gtttgccttt gccggacaag   960
 961 atcctgcgca atcattggta caagtatgaa gtcgagattt ga  1002
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
204544 205545 1 Glimmer3 score 6.49 poor
Genemark probabilities .69   - poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu