LOADING...
   NP_899917.1;MJ5552C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_899917.1    MJ5552C            JCSG 402589 PDB Deposition 13-JUN-28              PDB id: 4lgq

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_899917.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMChromobacterium violaceum atcc 12472
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF07366; SnoaL;
DR PDB; 4LGQ; Identical; 24-JUL-13; PUTATIVE POLYKETIDE CYCLASE;
DR FFAS; 402589; Fold and function assignment.
DR TVPC; NP_899917.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_899917.1; Ortholog view popup.
DR TPM; NP_899917.1; Target PDB monitor.
DR FSS; NP_899917.1; Target function coverage.
PROPERTY Residues: 139 aa
Molecule Weight: 14986.2 Dalton
Isoelectric Point: 5.73
Extinction Coefficient: 8480
Gravy Index: -.05
Number of Met residues: 5
Percentage of Met residues: 3.60 %
Number of Cys residues: 1
Percentage of Cys residues: 0.72 %
SEQUENCE  amino acids 139 aa
>NP_899917.1  gi|34495702|ref|NP_899917.1| hypothetical protein CV_0247 [Chromobacterium violaceum ATCC 12472]
MGDVMDTSKAVIQRFNREVIENGDMAAFAELVAPDFVNHSAPPGVSPGPDGFAGFFTGML
HPALSDIRVHIHEQIEENGKVVTRKTIEATHTGAFFGQPASGKRIAIHAMDIVVVRDGKY
AEHWSCADLYGALAQIRAA

CDS  cDNA 420 bp
   1 ttgggcgatg tcatggatac cagcaaggca gtgattcaac gtttcaaccg ggaagtgata    60
  61 gaaaacggcg acatggcggc gttcgccgaa ctggtggcgc ccgacttcgt caaccattcg   120
 121 gcgccgcccg gcgtgtcgcc ggggccggac ggtttcgccg gcttcttcac cggcatgctg   180
 181 catccggcgc tgtccgatat ccgcgtgcac atccacgagc agatcgagga aaacggcaag   240
 241 gtggtgacgc gcaagaccat agaggccacc cacaccggcg ccttcttcgg ccagcccgcc   300
 301 agcggcaagc gcatcgccat ccacgcgatg gacatcgtgg tagtgcgcga cggcaaatac   360
 361 gccgagcact ggagctgcgc cgacctgtac ggcgcgctcg cgcagatccg cgccgcctga   420
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu