LOADING...
   NP_816800.1;SP17422AA
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_816800.1    SP17422AA            JCSG 420195 PDB Deposition 13-DEC-02              PDB id: 4ntl

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_816800.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMEnterococcus faecalis v583
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF03180; Lipoprotein_9;
DR PDB; 4NTL; Identical; 11-DEC-13; LIPOPROTEIN, YAEC FAMILY;
DR PDB; 4YAH; Highly similar; 08-APR-15; D-METHIONINE-BINDING LIPOPROTEIN METQ;
DR PDB; 4K3F; Highly similar; 24-APR-13; PROBABLE TONB-DEPENDENT RECEPTOR;
DR PDB; 4IB2; Highly similar; 16-JAN-13; PUTATIVE LIPOPROTEIN;
DR PDB; 4QHQ; Highly similar; 18-JUN-14; LIPOPROTEIN;
DR PDB; 1XS5; Highly similar; 23-NOV-04; MEMBRANE LIPOPROTEIN TPN32;
DR PDB; 4GOT; Highly similar; 10-OCT-12; METHIONINE-BINDING LIPOPROTEIN METQ;
DR PDB; 3TQW; Highly similar; 21-SEP-11; METHIONINE-BINDING PROTEIN;
DR FFAS; 410767; Fold and function assignment.
DR TVPC; NP_816800.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_816800.1; Ortholog view popup.
DR TPM; NP_816800.1; Target PDB monitor.
DR FSS; NP_816800.1; Target function coverage.
PROPERTY Residues: 272 aa
Molecule Weight: 30059.72 Dalton
Isoelectric Point: 5.25
Extinction Coefficient: 17880
Gravy Index: -.35
Number of Met residues: 6
Percentage of Met residues: 2.21 %
Number of Cys residues: 2
Percentage of Cys residues: 0.74 %
SEQUENCE  amino acids 272 aa
>NP_816800.1  gi|29377646|ref|NP_816800.1| lipoprotein, YaeC family [Enterococcus faecalis V583]
MKKFYLATFAVIATVILAACGGNKQADQKEDKEITVAVQLESSKDILEIAKKEAEKKGYK
INIMEVSDNVAYNDAVQHDEADANFAQHQPFMEMFNKEKKADLVAVQPIYYFAGGFYSKE
YQDAKDLPENAKVGIPSDPTNEGRALAILNANGVIKLKEGVGFNGTVADVVENPKNITFE
SIDLLNLAKAYDEKDIAMVFCYPAYLEPAGLTTKDAILLEDKEASKHYALQVVTRKGEKD
SEKIKVLKEAMTTKEVAEYIKKNSKGANIPAF

CDS  cDNA 819 bp
   1 atgaagaagt tttatttagc aacattcgct gttattgcaa cagttatttt agctgcctgt    60
  61 gggggaaata aacaagcaga ccagaaagaa gacaaggaga ttaccgttgc cgtgcaattg   120
 121 gaatcttcaa aagatatctt ggagattgcc aagaaagaag ctgagaaaaa agggtacaaa   180
 181 attaacatta tggaagtgag cgacaatgtt gcctacaacg atgccgtgca acatgacgaa   240
 241 gcggatgcta attttgcgca acatcaaccc ttcatggaaa tgtttaacaa agagaaaaaa   300
 301 gctgatttag tggctgtgca accgatttat tattttgctg gtggtttcta ttcaaaagaa   360
 361 taccaagatg cgaaagattt acctgaaaat gccaaagtgg ggattcctag cgatccaacc   420
 421 aatgaaggtc gtgctttagc aattttaaat gcaaacggcg tgattaaatt aaaagaaggt   480
 481 gtcggcttta acggcacggt ggcagatgtc gtggaaaatc ctaaaaacat cacttttgaa   540
 541 agcattgatt tactgaattt agctaaagcc tatgatgaaa aagacatcgc tatggtgttc   600
 601 tgctacccag cctacttaga acctgctggt ttaacaacga aagatgcgat cttgttagaa   660
 661 gataaagaag caagtaaaca ttacgcattg caagttgtga cacgcaaagg cgaaaaagat   720
 721 agcgaaaaaa tcaaggtttt aaaagaagcg atgacaacaa aagaagttgc tgaatacatc   780
 781 aagaaaaatt ctaaaggcgc caatattcct gcgttttaa   819
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
3070588 3071406 -1 Glimmer3 score 14.19 good
Genemark probabilities .88   .65 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu