LOADING...
   NP_816685.1;GS13485B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_816685.1    GS13485B            JCSG 389959 PDB Deposition 13-AUG-25              PDB id: 4me8

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_816685.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMEnterococcus faecalis v583
COMMENT 
DR UNIPROT; Q82ZI3_ENTFA
DR SPTR; Q82ZI3 (flat text); Q82ZI3 (good view)
DR GenBank; NP_816685
DR Pfam; PF00717; Peptidase_S24;
DR PDB; 4ME8; Identical; 11-SEP-13; SIGNAL PEPTIDASE I;
DR PDB; 4NV4; Highly similar; 18-DEC-13; SIGNAL PEPTIDASE I;
DR FFAS; 384341; Fold and function assignment.
DR TVPC; NP_816685.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_816685.1; Ortholog view popup.
DR TPM; NP_816685.1; Target PDB monitor.
DR FSS; NP_816685.1; Target function coverage.
PROPERTY Residues: 178 aa
Molecule Weight: 20181 Dalton
Isoelectric Point: 8.8
Extinction Coefficient: 18910
Gravy Index: -.21
Number of Met residues: 3
Percentage of Met residues: 1.69 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 178 aa
>NP_816685.1  gi|29377531|ref|NP_816685.1| signal peptidase I [Enterococcus faecalis V583]
MSSLLKRLVQLVLLVVAVLLIRHYVFSPAAVNGSSMEPTLHNNDRLWVTSIKKPQRFDII
AFPSPRNGQRVAKRLIGLPGETVEYRDDTLYINGVSLSEDYLASAKRNVSKNENYTQDFT
LETLEATQSLTVPEGMYFVLGDNRPRSDDSRYFGFVKQASVEGVLTFRYYPLDKIGFP

CDS  cDNA 537 bp
   1 atgtcctcat tattaaaacg attggttcag ttggttttgt tagtcgtcgc tgtcttgctg    60
  61 attcgacact atgttttctc ccctgctgcg gtgaacggct cttcaatgga accaacactt   120
 121 cataacaacg accgtttatg ggtgacctcg attaaaaaac cacagcgctt tgatattatc   180
 181 gctttcccta gtcctcgcaa cggccaacga gtagccaaac gtttaattgg tttacctggc   240
 241 gaaacagtcg agtatcgcga tgataccctt tatattaatg gtgtatcact cagtgaagat   300
 301 tacttagcaa gtgctaaacg aaatgtctct aaaaatgaaa attataccca agattttacg   360
 361 ctagagacct tagaagccac ccaatccctg accgttccag aaggcatgta ttttgtcttg   420
 421 ggggataatc gcccgcgctc agacgacagt cgttattttg gctttgttaa acaagcgagt   480
 481 gtggaaggtg ttttgacttt tcgttattat ccattagata aaattggctt tccataa   537
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2942769 2943305 3 Glimmer3 score 8.26 poor
Genemark probabilities .82   .03 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu