LOADING...
   NP_814166.1;SP18758C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_814166.1    SP18758C            JCSG 420207 PDB Deposition 13-DEC-05              PDB id: 4nw4

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_814166.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMEnterococcus faecalis v583
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4NW4; Identical; 19-FEB-14; LIPOPROTEIN S-LAYER PROTEIN;
DR PDB; 4KH8; Highly similar; 15-MAY-13; HYPOTHETICAL PROTEIN;
DR FFAS; 410784; Fold and function assignment.
DR TVPC; NP_814166.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_814166.1; Ortholog view popup.
DR TPM; NP_814166.1; Target PDB monitor.
DR FSS; NP_814166.1; Target function coverage.
PROPERTY Residues: 321 aa
Molecule Weight: 35456.53 Dalton
Isoelectric Point: 7.07
Extinction Coefficient: 31860
Gravy Index: -.6
Number of Met residues: 2
Percentage of Met residues: 0.62 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 321 aa
>NP_814166.1  gi|29375013|ref|NP_814166.1| hypothetical protein EF0375 [Enterococcus faecalis V583]
MKKKVLSSITLVTLSTLLIAGYASPAFADHAANPNSATANLGKHQNNGQTRGDKATKILS
GTDWQGTRVYDAAGNDLTAENANFIGLAKYDGETGFYEFFDKNTGETRGDEGTFFVTGDG
TKRILISRTQNYQAVVDLTEVSKDKFTYKRLGKDKLGNDVEVYVEHIPYHGKKLAFTNGR
EALTNQTGKIVTNKSGDKILGTTLWNGTKVVDKNGNDVTAANQNFISLAKFDPNTSKYEF
FNLQTGETRGDFGYFQVVDNNKIRAHVSIGTNRYGAALELTELNNDRFTYTRMGKDNAGN
DIQVFVEHEPYQGTYHPAFTF

CDS  cDNA 966 bp
   1 atgaaaaaga aagtattaag ttcgattact ttagtaacat taagtacgtt acttatagca    60
  61 ggttatgcaa gtccagcatt tgcagatcat gcagccaatc caaatagtgc tacagcaaat   120
 121 ttaggcaaac atcaaaacaa tggccaaaca agaggcgaca aggcgactaa gattttatct   180
 181 ggcacggact ggcaaggaac ccgtgtttat gatgctgctg gtaatgattt aacggcagaa   240
 241 aatgctaatt ttattggttt agcaaaatat gatggtgaaa ccggttttta cgagtttttc   300
 301 gacaaaaata ctggggaaac ccgtggtgac gaaggaacat tttttgtgac aggtgatggc   360
 361 acaaaacgaa ttttaatttc gcggacacaa aattatcaag ccgtagtgga tttaaccgaa   420
 421 gtgagtaaag acaaatttac ttacaagcgt ttagggaaag ataaactggg gaatgatgtt   480
 481 gaagtttacg tggaacacat cccttatcat gggaaaaaat tagcttttac aaatggacgt   540
 541 gaagcattaa ccaatcaaac tggcaaaatt gtgacaaata aatcagggga taaaatttta   600
 601 ggaacaacct tgtggaatgg cacaaaagtc gtagataaaa acggtaatga tgtgacagcg   660
 661 gccaatcaaa atttcattag tttagcgaaa tttgatccaa acacaagtaa atatgaattt   720
 721 ttcaatttac aaacaggtga aacccgcggc gactttgggt acttccaagt ggtggacaat   780
 781 aacaagattc gggcccatgt atctattggt acgaatcgtt acggcgcggc gctagaatta   840
 841 acggaactaa acaatgatcg atttacgtat actcgaatgg gtaaagataa tgctggtaat   900
 901 gatattcaag tgttcgtgga acatgaacct taccaaggca catatcatcc agcctttact   960
 961 ttctaa   966
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
343670 344635 2 Glimmer3 score 10.15 poor
Genemark probabilities .93   .92 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu