LOADING...
   NP_812693.1;PX5927B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_812693.1    PX5927B            JCSG 396216 PDB Deposition 13-SEP-20              PDB id: 4mu9

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_812693.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides thetaiotaomicron vpi-5482
COMMENT 
DR UNIPROT; Q8A184_BACTN
DR SPTR; Q8A184 (flat text); Q8A184 (good view)
DR GenBank; NP_812693
DR PDB; 4MU9; Identical; 09-OCT-13; GLYCOSIDE HYDROLASE FAMILY 73;
DR PDB; 4C1S; Highly similar; 13-NOV-13; GLYCOSIDE HYDROLASE FAMILY 76 MANNOSIDASE;
DR PDB; 3K7X; Highly similar; 27-OCT-09; LIN0763 PROTEIN;
DR FFAS; 395692; Fold and function assignment.
DR TVPC; NP_812693.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_812693.1; Ortholog view popup.
DR TPM; NP_812693.1; Target PDB monitor.
DR FSS; NP_812693.1; Target function coverage.
PROPERTY Residues: 387 aa
Molecule Weight: 44549.41 Dalton
Isoelectric Point: 8.14
Extinction Coefficient: 105200
Gravy Index: -.52
Number of Met residues: 8
Percentage of Met residues: 2.07 %
Number of Cys residues: 10
Percentage of Cys residues: 2.58 %
SEQUENCE  amino acids 387 aa
>NP_812693.1  gi|29349190|ref|NP_812693.1| putative hydrolase [Bacteroides thetaiotaomicron VPI-5482]
MRNICFVACMLFCLASASGKTVKNHPFVSIADSILDNVLNLYQTEDGLLTETYPVNPDQK
ITYLAGGAQQNGTLKASFLWPYSGMMSGCVAMYQATGDKKYKTILEKRILPGLEQYWDGE
RLPACYQSYPVKYGQHGRYYDDNIWIALDYCDYYRLTKKADYLKKAIALYEYIYSGWSDE
LGGGIFWCEQQKEAKHTCSNAPSTVLGVKLYRLTKDKKYLNKAKETYAWTRKHLCDPDDF
LYWDNINLKGKVSKDKYAYNSGQMIQAGVLLYEETGDKDYLRDAQKTAAGTDAFFRSKAD
KKDPSVKVHKDMSWFNVILFRGFKALEKIDHNPTYVRAMAENALHAWRNYRDANGLLGRD
WSGHNEEPYKWLLDNACLIELFAEIEK

CDS  cDNA 1164 bp
   1 atgagaaata tatgttttgt agcctgtatg ttgttttgcc tcgcttccgc ttccggaaaa    60
  61 acggtgaaaa atcatccttt cgtgtccatt gccgactcta tcctcgacaa tgttctgaat   120
 121 ttatatcaga cggaagacgg gctgcttacc gaaacatatc ccgtgaatcc cgaccagaaa   180
 181 atcacttatc tggcaggcgg agcacagcag aacggaacct tgaaggcctc ctttctgtgg   240
 241 ccctactcag ggatgatgtc cggttgcgta gccatgtacc aggctaccgg agacaagaag   300
 301 tacaagacga tactggaaaa gcgcatcctg ccgggactgg aacagtactg ggacggagaa   360
 361 cgccttccgg catgctatca gtcgtaccct gtcaaatacg gtcagcatgg acgctactac   420
 421 gatgacaaca tctggatcgc actggattat tgcgactact accgcctcac aaagaaggcc   480
 481 gactatctga aaaaggccat tgccctgtac gaatacatct acagcggctg gagtgacgaa   540
 541 ctgggcggag gaatcttctg gtgcgaacag cagaaagaag cgaagcatac ctgctccaat   600
 601 gccccgtcaa cagtactcgg cgtcaagcta taccgtctga cgaaggacaa aaagtatctg   660
 661 aacaaggcca aggaaactta cgcatggacc agaaaacact tgtgtgatcc cgacgacttc   720
 721 ctttactggg acaatatcaa cctgaaaggg aaagtctcga aagacaagta cgcctacaac   780
 781 agtggacaaa tgattcaggc aggtgtatta ctgtacgaag agacaggaga caaggattac   840
 841 ttgcgcgatg cccagaagac agccgcggga accgatgcct ttttccgttc gaaagcagat   900
 901 aagaaagacc cgtcagtcaa ggtacacaag gatatgtcgt ggtttaacgt gattctgttc   960
 961 agaggcttca aggcgctgga gaagattgac cacaacccga cttatgtccg tgcgatggca  1020
1021 gagaacgcgc tccacgcatg gagaaactac cgggatgcca acggattact gggcagagac  1080
1081 tggtcaggac ataacgagga accttataaa tggctgctcg ataatgcctg cctgatcgag  1140
1141 ctgttcgctg aaatcgagaa ataa  1164
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
4908210 4909373 -3 Glimmer3 score 9.13 poor
Genemark probabilities .91   .04 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu