LOADING...
   NP_812419.1;SP15308D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_812419.1    SP15308D            JCSG 420140 PDB Deposition 14-JUN-18              PDB id: 4qni

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_812419.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides thetaiotaomicron vpi-5482
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF08522; DUF1735;
DR PDB; 4QNI; Identical; 13-AUG-14; UNCHARACTERIZED PROTEIN;
DR PDB; 3NQK; Highly similar; 04-AUG-10; UNCHARACTERIZED PROTEIN;
DR PDB; 3SOT; Highly similar; 27-JUL-11; MULTIDOMAIN PROTEIN INCLUDING DUF1735;
DR PDB; 3P02; Highly similar; 20-OCT-10; UNCHARACTERIZED PROTEIN;
DR FFAS; 408691; Fold and function assignment.
DR TVPC; NP_812419.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_812419.1; Ortholog view popup.
DR TPM; NP_812419.1; Target PDB monitor.
DR FSS; NP_812419.1; Target function coverage.
PROPERTY Residues: 353 aa
Molecule Weight: 39919.08 Dalton
Isoelectric Point: 4.66
Extinction Coefficient: 59710
Gravy Index: -.49
Number of Met residues: 6
Percentage of Met residues: 1.70 %
Number of Cys residues: 2
Percentage of Cys residues: 0.57 %
SEQUENCE  amino acids 353 aa
>NP_812419.1  gi|29348916|ref|NP_812419.1| hypothetical protein BT3507 [Bacteroides thetaiotaomicron VPI-5482]
MKKIYTLAALAAMTMLGTSCNSEWEDEQYEHYISFSSQLDSKGVTNIYVPYSRHDAEGNY
AEGGEGRSNYQLPILVSGSTDNPSNVTVHVAHDADTLNILNYARYATRTELYYEDMGAEG
LAYASYPESLQIKAGENKGLLDLKFDFRNIDMSEKWVLPLQIVDDASYNYVAHPRKDYAK
AILRIFPFNDYSGDYSGTGITNKVVTGYDGDGKPIETAESITKSSIRGYVIDEQTIFTYA
GIVDEDYTDRRKYKIKFAFNGETNGSVTISCDNAEEIGFELNKDVTPSFRISSSMDDAKP
YLEHRYVIINNVDYYFNYIPVEGTIIRYHVKGTLTLSRDINTQIPDEDQAIEW

CDS  cDNA 1062 bp
   1 atgaagaaaa tatatacttt ggcagctttg gctgcaatga caatgttggg aacttcctgc    60
  61 aattcggaat gggaagatga acaatatgag cactacattt ctttcagttc acaactggat   120
 121 agtaagggag tgacgaatat atatgtacct tatagccgcc atgatgcaga aggaaattat   180
 181 gcagaaggag gagaagggag gtccaattat cagttaccga tacttgttag tggttctacc   240
 241 gataatccaa gtaatgtcac tgtacacgta gcacatgatg ctgatacatt gaatattttg   300
 301 aattacgctc gttacgctac acgtacagaa ctatattatg aggatatggg agcagaagga   360
 361 ttggcatacg cttcatatcc agaatctcta cagataaaag caggagaaaa taaaggttta   420
 421 ctggatctta aatttgattt tcgcaacatt gatatgtcag aaaaatgggt acttccattg   480
 481 cagattgtag acgacgcgtc ttacaactac gtagctcatc cacgtaaaga ctatgctaag   540
 541 gcgatattga gaatcttccc atttaatgat tactctggcg attattctgg tacaggaata   600
 601 accaacaagg tggtgacggg atatgatgga gatggtaaac cgatagaaac agcagaatct   660
 661 atcacaaaat cgtcaataag agggtatgtg atagatgaac agactatttt tacgtatgca   720
 721 ggaatagtag atgaggatta tacagaccgt agaaagtata aaatcaaatt tgcttttaat   780
 781 ggtgagacga atggttcggt tactatttcc tgtgataatg cagaagagat tggatttgaa   840
 841 ttaaacaagg acgtgactcc ttcatttcgt atttcttcat caatggatga cgcgaagcct   900
 901 tatctggaac accgttatgt aataattaat aatgttgatt attatttcaa ttatatacca   960
 961 gtggaaggta ccatcattcg ctatcatgta aaaggtacat tgacattatc acgtgatatc  1020
1021 aatactcaga ttccagacga agatcaagca attgaatggt ag  1062
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
4525023 4526084 3 Glimmer3 score 5.93 poor
Genemark probabilities .84   .2 poor
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu