LOADING...
   NP_812134.1;GS13536A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_812134.1    GS13536A            JCSG 386369 PDB Deposition 13-JUN-20              PDB id: 4lb8

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_812134.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides thetaiotaomicron vpi-5482
COMMENT 
DR UNIPROT; Q8A2T3_BACTN
DR SPTR; Q8A2T3 (flat text); Q8A2T3 (good view)
DR GenBank; NP_812134
DR PDB; 4LB8; Identical; 10-JUL-13; UNCHARACTERIZED PROTEIN;
DR FFAS; 384667; Fold and function assignment.
DR TVPC; NP_812134.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_812134.1; Ortholog view popup.
DR TPM; NP_812134.1; Target PDB monitor.
DR FSS; NP_812134.1; Target function coverage.
PROPERTY Residues: 310 aa
Molecule Weight: 34923.86 Dalton
Isoelectric Point: 5.78
Extinction Coefficient: 33350
Gravy Index: -.27
Number of Met residues: 10
Percentage of Met residues: 3.23 %
Number of Cys residues: 4
Percentage of Cys residues: 1.29 %
SEQUENCE  amino acids 310 aa
>NP_812134.1  gi|29348631|ref|NP_812134.1| hypothetical protein BT3222 [Bacteroides thetaiotaomicron VPI-5482]
MKKLFSTLTLTVCLGAFISCTNDEQEVNMVKPTNANSEIEVINDGTMIKFKDVESYENAL
LKVSAMSTSEQVSFLNSLSFKSQMILMQEADGELDKICNQAADKAEFDVLYEKYKHKYGD
VFMFNTIDATDLSPYSRLVYVANEYFVNMKGEFMIGDSLVVDKVYTDFKERQQQFTVSTR
SSVSDLSSINEAYSRQKDRKVGLYLSVSSGIIHANFTSQKKGVFGWSRYSTTYHAKVNLR
GFEFAQGELLGYGPVYVNKDGIPFAIDTKEMGGNVTKVFGRKLAQECTGTIEIWSRGVPY
DQRGFATVRL

CDS  cDNA 933 bp
   1 atgaaaaaac tattttcaac actgacacta acagtatgtt taggtgcatt tatttcttgt    60
  61 accaatgatg aacaggaagt gaatatggtt aaaccgacga atgctaattc tgaaatagaa   120
 121 gtaataaacg acggtactat gattaaattt aaagatgtgg aatcgtacga gaatgctctt   180
 181 ttgaaagtga gtgcaatgtc tacttcagaa caagttagtt ttcttaattc attatctttt   240
 241 aagtctcaga tgattctgat gcaagaagcg gatggtgagt tggataaaat ctgtaatcaa   300
 301 gctgctgata aagcggagtt tgatgttcta tatgagaaat ataaacataa atatggtgat   360
 361 gtatttatgt ttaatactat cgatgctact gatctgtcac cttattcaag gcttgtttat   420
 421 gtagccaatg aatactttgt taatatgaaa ggtgaattta tgattggcga ttctttggtt   480
 481 gtggataagg tatatactga ctttaaagag cgtcaacaac aatttacggt ttctactcgt   540
 541 tcgtctgttt cagatttaag ttctataaac gaagcatata gtcgtcaaaa agatagaaaa   600
 601 gtaggattat atttatctgt ttcatcagga ataatacatg ctaattttac ttcgcaaaag   660
 661 aaaggagtct ttggatggag ccgttactct acgacatacc atgctaaagt aaaccttcgt   720
 721 ggttttgagt ttgctcaagg agaactactg gggtatggtc cagtgtatgt aaataaagat   780
 781 ggtattcctt ttgctattga taccaaagaa atgggtggaa atgtaaccaa agtttttgga   840
 841 cgtaagttag cacaagagtg tacgggtaca atagaaatct ggtctcgggg tgtgccgtat   900
 901 gaccaaagag gatttgccac tgtgagatta taa   933
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
4114044 4114976 3 Glimmer3 score 4.8 poor
Genemark probabilities .61   - poor
GenemarkHMM class 2 poor

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu