LOADING...
   NP_811570.1;C.KN13462A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_811570.1    C.KN13462A            JCSG 425067 PDB Deposition 14-MAY-13              PDB id: 4qdg

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_811570.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides thetaiotaomicron vpi-5482
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF08842; Mfa2;
DR PDB; 4QDG; Identical; 11-JUN-14; PUTATIVE ADHESIN;
DR PDB; 3GF8; Highly similar; 24-MAR-09; PUTATIVE POLYSACCHARIDE BINDING PROTEINS (DUF1812 CHAIN: A;
DR PDB; 3PAY; Highly similar; 10-NOV-10; PUTATIVE ADHESIN;
DR FFAS; 425067; Fold and function assignment.
DR TVPC; NP_811570.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_811570.1; Ortholog view popup.
DR TPM; NP_811570.1; Target PDB monitor.
DR FSS; NP_811570.1; Target function coverage.
PROPERTY Residues: 338 aa
Molecule Weight: 38961.21 Dalton
Isoelectric Point: 4.84
Extinction Coefficient: 62800
Gravy Index: -.3
Number of Met residues: 12
Percentage of Met residues: 3.55 %
Number of Cys residues: 5
Percentage of Cys residues: 1.48 %
SEQUENCE  amino acids 338 aa
>NP_811570.1  gi|29348067|ref|NP_811570.1| hypothetical protein BT2657 [Bacteroides thetaiotaomicron VPI-5482]
MHNKKRNIISGFISTVLGIVLINFAFSSCERIYEDLAPCPHGVSLRFIYDYNMEYANAFA
KKVDCLTLLVYDENGNYVDTRIVTGTELQDENYRMKLDLKQGNYHFVAYGGLACNKSSFL
MKYTPGEGTGYTDLQVELDSECLTNPRRKNLHGLYWGELTLATADLYSEGTVEMMKNTNN
IRVVLQQMNGEPVDDKKFEFEITDDNILFSYDNNLLENGMVTYTPWAQGQASAGFTDEGR
EVVVAYAELSTSRLMVRDWYSPKLTVRRKADGVEIINIPLINYLLMLKSDLYASMDSQEF
LDRESEWSMIFFLSPNLEWIKTYIKINDWTVRINDIRQ

CDS  cDNA 1017 bp
   1 atgcataata aaaaacgaaa tataatttca gggtttatca gtacggtgct tggcatcgta    60
  61 ctgataaatt ttgccttttc atcgtgtgag cgtatctatg aagatcttgc tccatgtccg   120
 121 catggcgtgt cactacgctt catttacgac tacaatatgg aatatgccaa tgcatttgct   180
 181 aagaaggtgg attgtctgac attgctggtc tatgatgaaa atggcaatta tgtggatact   240
 241 cgcatagtga cgggtacgga gttgcaggac gagaactatc gcatgaagct ggacctcaaa   300
 301 caaggaaatt atcatttcgt agcttatggt ggtctggctt gtaataagag ctctttcctt   360
 361 atgaagtata cccccggaga aggaactgga tataccgatt tgcaagtgga actagattcg   420
 421 gaatgcttga caaatcccag acgaaagaac ttgcacggtt tgtattgggg tgaacttact   480
 481 ctcgctactg ccgaccttta cagtgaaggc actgttgaga tgatgaagaa caccaataat   540
 541 attcgtgttg tgttgcaaca aatgaatggt gagccggtag atgataagaa atttgaattt   600
 601 gaaattaccg atgataatat actgttcagt tacgataata atttgcttga gaatggtatg   660
 661 gtgacataca ctccatgggc acaagggcaa gcttcggcag gattcactga tgagggaaga   720
 721 gaagtggtgg tagcttatgc cgaactatct acttcacggt tgatggtgcg tgattggtac   780
 781 tcgcctaagc tgacggtgcg tcgcaaagca gatggtgtgg aaattatcaa tattccactt   840
 841 attaactatt tgcttatgct taagagtgat ctgtatgcaa gcatggattc gcaggagttc   900
 901 cttgatcgtg aaagtgaatg gtcaatgata ttcttcttaa gcccgaatct tgaatggatt   960
 961 aaaacttata ttaagataaa cgattggact gtcagaatca acgatataag acaatga  1017
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
3310981 3311997 -1 Glimmer3 score 3.68 poor
Genemark probabilities .83   .01 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu