LOADING...
   NP_811172.1;GS13194A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_811172.1    GS13194A            JCSG 386313 PDB Deposition 14-APR-21              PDB id: 4q69

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_811172.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides thetaiotaomicron vpi-5482
COMMENT 
DR UNIPROT; Q8A5I0_BACTN
DR SPTR; Q8A5I0 (flat text); Q8A5I0 (good view)
DR GenBank; NP_811172
DR PDB; 4Q69; Identical; 25-JUN-14; PUTATIVE LIPOPROTEIN;
DR FFAS; 384616; Fold and function assignment.
DR TVPC; NP_811172.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_811172.1; Ortholog view popup.
DR TPM; NP_811172.1; Target PDB monitor.
DR FSS; NP_811172.1; Target function coverage.
PROPERTY Residues: 488 aa
Molecule Weight: 54864.15 Dalton
Isoelectric Point: 4.59
Extinction Coefficient: 106230
Gravy Index: -.31
Number of Met residues: 18
Percentage of Met residues: 3.69 %
Number of Cys residues: 7
Percentage of Cys residues: 1.43 %
SEQUENCE  amino acids 488 aa
>NP_811172.1  gi|29347669|ref|NP_811172.1| hypothetical protein BT2259 [Bacteroides thetaiotaomicron VPI-5482]
MIMKKKILAYALSALTCGLFTSCSDWLDINHDPNTAEKVDPGYLFNYVAVNWAGTRTGGD
FYIPLSMSSQCQVDGGLDYGGWDESVYTISPYSTGNTWKHYYSVGGNNLMLAIKNAEEAD
PVNHNAIAQCKILLAEHMYEATMLWGDIPFTESWNGTIKYPKFDSQESVLNGVLSLLDEA
LQIMDLNDANAIDEYDIYYKGDMNKWMTLAKSLKFRTLMVMVDKDPSKATAIGTLLQAGG
MVSSASDNLVFPYSAEPGNQNPKYELIELVGGTQILFFASNYMLKPMQERNDPRIPCYFE
PGADGVYRGLGNREPAVTDDKDNMLSSVVSSYLFRKDAPELIYSCQEQLLLEAEAYARGL
GVAQNLSKANELYKKGIREACAFYGVAEADIDTYVTGLPELTALTQEKALYEIHMQQWID
LMDRPFEEFVQWRRSGTAGNEVPTLQVPEDATSKELIRRWEYSPEEMTANINAPKESPKI
WEKLWFDL

CDS  cDNA 1467 bp
   1 atgattatga aaaagaaaat attagcatat gcattgagcg ctttgacatg tgggttattt    60
  61 acttcatgca gcgactggct tgatatcaac catgacccca atactgccga gaaagttgat   120
 121 cccggatatt tgtttaacta tgtagccgta aactgggccg gaacacgtac cggtggtgac   180
 181 ttctatattc cgttatcaat gagttcacag tgtcaggttg atggtggact tgattatggt   240
 241 ggctgggatg aatcggtata taccatttcc ccttatagta caggaaatac gtggaaacat   300
 301 tactactctg tcggtggtaa taacttgatg ctggctatta aaaatgcgga agaagcagat   360
 361 ccggtgaatc acaatgctat tgcacagtgt aagattctgt tggctgaaca tatgtatgaa   420
 421 gcgacgatgc tatgggggga tatccctttc actgaatctt ggaacggaac aattaagtat   480
 481 ccgaaatttg attctcagga aagtgtattg aatggggtgt tgtcattgct tgatgaagca   540
 541 ctgcagatca tggatttgaa tgatgccaat gcgattgatg aatacgatat ctattataaa   600
 601 ggtgatatga ataaatggat gactttggcc aaatctttaa agttcagaac actgatggtt   660
 661 atggtggaca aagatccttc taaagctact gccattggta cgttgttaca ggctggaggc   720
 721 atggtatcat cagcatcaga taatttggtg ttcccttatt ctgcagaacc gggtaaccag   780
 781 aatcctaagt atgaacttat agaattggtt ggcggtacac agatattgtt ttttgccagc   840
 841 aactatatgc tgaagccgat gcaggaacgt aatgaccccc gtattccttg ttattttgaa   900
 901 ccgggtgccg acggtgtata tagaggctta ggtaaccgtg aacctgctgt tactgatgac   960
 961 aaagataata tgttatcatc tgttgtgagc agttatcttt tcagaaaaga tgcaccggag  1020
1021 ttaatatact cttgccagga gcagttgctt ctggaagcgg aagcttatgc gcgcggtttg  1080
1081 ggagttgctc agaatttgtc gaaggctaat gaattgtata agaaaggcat tcgggaagca  1140
1141 tgtgcatttt atggagtagc ggaagcggat attgatacat atgttacagg tttgccggaa  1200
1201 ttgacagcgc tgactcagga gaaagcactg tatgagattc atatgcagca gtggattgat  1260
1261 ttaatggatc gtccgtttga ggagtttgta cagtggagac gttctggtac tgctggaaat  1320
1321 gaagtcccga ccttacaagt gccggaagat gcaacttcaa aagaactgat cagaagatgg  1380
1381 gagtatagcc cggaagagat gactgctaat atcaatgcac cgaaagaatc tccgaaaatt  1440
1441 tgggaaaagt tatggtttga tttataa  1467
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2834000 2835466 -2 Glimmer3 score 7.07 poor
Genemark probabilities .89   .25 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu