LOADING...
   NP_810851.1;FR15002A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_810851.1    FR15002A            JCSG 392884 PDB Deposition 14-APR-04              PDB id: 4q1z

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_810851.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides thetaiotaomicron vpi-5482
COMMENT 
DR UNIPROT; Q8A6E6_BACTN
DR SPTR; Q8A6E6 (flat text); Q8A6E6 (good view)
DR GenBank; NP_810851
DR PDB; 4Q1Z; Identical; 23-APR-14; PUTATIVE LIPOPROTEIN;
DR FFAS; 392884; Fold and function assignment.
DR TVPC; NP_810851.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_810851.1; Ortholog view popup.
DR TPM; NP_810851.1; Target PDB monitor.
DR FSS; NP_810851.1; Target function coverage.
PROPERTY Residues: 399 aa
Molecule Weight: 44384.11 Dalton
Isoelectric Point: 4.52
Extinction Coefficient: 67730
Gravy Index: -.38
Number of Met residues: 8
Percentage of Met residues: 2.01 %
Number of Cys residues: 3
Percentage of Cys residues: 0.75 %
SEQUENCE  amino acids 399 aa
>NP_810851.1  gi|29347348|ref|NP_810851.1| hypothetical protein BT1938 [Bacteroides thetaiotaomicron VPI-5482]
MSGTAEVNPITVDVYLDITVENISTLKDLTVKFDNYDEDLHYVKEVTDNSVKVDGIIPGI
YSVTVSGTAIDTENNEYYINGNSVNAALFKHGSALNIEVQGLKVSPLIFKEIYYCGSRPE
KGGVYFRDQFYEIYNNSADILYLDGIYFANLTPGTATTKLPIWPEADGNNYAYGERVWKF
PGNGTEYPLAPGESCIISQFAANHQLDIYNPQSPIDGSSSEFEFNMNNPNFPDQAAYDMQ
HVFYQGKAEMGSIPQYLTSVFGGAYVIFRVPEGEAWDPVNDENMKTTDLSKPNSNVYYAK
IPIKYVLDAVEAVNNESKMNAKRVPGVLDAGITWVGATYCGLGIARKLSTDEEGNPIIRE
ETGTYIYQDTNNSTDDFERGVVPVMRRNGAKMPSWNHTL

CDS  cDNA 1200 bp
   1 atgtctggca cagcagaagt gaatcctatc acagtggatg tatatttgga tattaccgtt    60
  61 gaaaatatat ccacactgaa agatctgact gtaaagttcg acaattacga tgaagattta   120
 121 cattatgtaa aagaagtaac tgataatagt gtgaaagttg acggaattat ccccggaatt   180
 181 tattcggtaa cagtatccgg tacagcgatc gatacagaaa acaatgaata ctacatcaat   240
 241 ggcaattctg taaatgcggc attatttaag catggtagcg cattgaatat tgaagtacaa   300
 301 gggcttaaag tgagcccatt aatattcaag gagatttatt attgcggtag ccgtccggaa   360
 361 aaaggaggag tctatttccg agaccagttc tatgagatat acaataactc tgctgacatt   420
 421 ttgtatttgg acggtattta tttcgcaaat ttaactccgg gtacagctac cactaaatta   480
 481 cctatttggc cggaagcgga cggtaataat tatgcatatg gagaacgtgt gtggaaattt   540
 541 ccaggaaatg gaaccgaata tccgttagcg ccaggtgaat cttgcatcat ttctcaattt   600
 601 gccgctaacc atcagttgga catctataac cctcaaagtc ctatagacgg cagtagttct   660
 661 gagtttgagt ttaatatgaa taatccaaac ttccctgacc aggcagctta tgatatgcaa   720
 721 catgttttct accaaggaaa agcagagatg ggaagtatac cacaatattt gacatccgta   780
 781 ttcggaggtg cttatgtgat ttttcgtgtt cctgaaggag aagcttggga tccggtcaac   840
 841 gatgaaaata tgaagacaac agatcttagc aaaccgaaca gcaatgttta ttatgcaaaa   900
 901 atacctatta aatatgtatt ggatgctgtt gaagcagtaa acaatgagtc aaagatgaat   960
 961 gcaaaacgtg tccccggtgt acttgatgca ggtattactt gggtaggagc tacttattgc  1020
1021 ggtttaggta ttgctcgcaa attgtccaca gacgaagaag gtaatcctat tattcgcgaa  1080
1081 gaaacaggta catatatata tcaggataca aacaacagta cggatgactt tgaacgtggc  1140
1141 gttgttcctg taatgcgtcg taatggagca aaaatgcctt catggaatca cacattgtaa  1200
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2436475 2437674 -1 Glimmer3 score 6.44 poor
Genemark probabilities .9   .77 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu