LOADING...
   NP_810400.1;GS13402A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_810400.1    GS13402A            JCSG 386272 PDB Deposition 14-AUG-21              PDB id: 4r5o

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_810400.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides thetaiotaomicron vpi-5482
COMMENT 
DR UNIPROT; Q8A7N7_BACTN
DR SPTR; Q8A7N7 (flat text); Q8A7N7 (good view)
DR GenBank; NP_810400
DR PDB; 4R5O; Identical; 10-SEP-14; QUINONPROTEIN ALCOHOL DEHYDROGENASE-LIKE PROTEIN;
DR FFAS; 385360; Fold and function assignment.
DR TVPC; NP_810400.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_810400.1; Ortholog view popup.
DR TPM; NP_810400.1; Target PDB monitor.
DR FSS; NP_810400.1; Target function coverage.
PROPERTY Residues: 448 aa
Molecule Weight: 49626.06 Dalton
Isoelectric Point: 4.97
Extinction Coefficient: 48710
Gravy Index: -.26
Number of Met residues: 3
Percentage of Met residues: 0.67 %
Number of Cys residues: 9
Percentage of Cys residues: 2.01 %
SEQUENCE  amino acids 448 aa
>NP_810400.1  gi|29346897|ref|NP_810400.1| hypothetical protein BT1487 [Bacteroides thetaiotaomicron VPI-5482]
MNKLYTTLLIACLAAGFTACNDDDCEDLHLGNLAHYPNVLKGTFPTESQVLELGETLEIT
PELLNPEGATYSWLVNGKEYSTEPTFSYKIDNPCRADLSCIIKNKYGKVEMSTSFSSNHN
FSKGFFYVADGTFNFYDTEKKTAYQDCYASLNAGKTLGIGNYDSANIIHSNGKFYLLVGT
STSNRDHFYIVDAKTLYYENSAVVGANLSGLTILNEQYGLVTGDGIRRIDLKSLNNVRIK
NERLLCFYNSIIYNGKVLSNDTYKDESKVKYYDVNELIAAKEGEAPAVTELDIIQKQKIN
FVLAKDGNVYTLESADNGCNIVKIKNDFTLEKVFANFQPAKGPYHSSPTIGMVASETENI
IYLVSTDGAIYKYILGDSDSLKAPFIAAESGVSITAPLQLNQQSGELYVTYTEERKDESK
IVVYSKDGKVLHTVDCGESVPSQILFNN

CDS  cDNA 1347 bp
   1 atgaataaac tatataccac tttattaata gcctgccttg cagcaggttt taccgcctgt    60
  61 aacgacgacg attgcgaaga tttgcacctc ggcaatctgg cacattatcc gaacgtactg   120
 121 aaaggaactt tcccgacaga aagccaagtg ttggaattag gagaaacgtt ggagattact   180
 181 ccggaactgc ttaatccgga aggagccacc tattcatggc tggtcaatgg aaaagagtat   240
 241 tctaccgaac cgacctttag ttacaaaata gacaatccat gtcgcgcgga cctgtcatgt   300
 301 atcatcaaga ataaatacgg aaaagtagaa atgagcacaa gtttcagctc taaccacaac   360
 361 ttttccaaag gattcttcta cgtagcagac ggaacattca atttctatga taccgaaaag   420
 421 aaaactgctt atcaagattg ttatgcttct ttaaatgcag gaaaaacttt gggaattggt   480
 481 aactacgact ctgcaaatat cattcacagc aacggaaagt tctatctgct tgtgggcacc   540
 541 agcacatcga accgagatca tttctacatt gtcgacgcca agactcttta ttacgaaaac   600
 601 tccgctgtag taggcgcaaa cctaagcggt ctgaccattc tgaacgaaca atatggatta   660
 661 gtgacaggag atggcatacg tcgtattgac ctaaaatcac ttaacaatgt caggatcaag   720
 721 aatgagcgtc tgctttgttt ctataatagc ataatctaca atggcaaagt gctgagcaat   780
 781 gacacttata aagatgagtc caaagtgaag tattacgatg taaacgaact aatcgcagct   840
 841 aaagaaggag aagctcctgc cgttacagag ctagatatca ttcaaaaaca gaaaatcaat   900
 901 tttgtactgg ctaaagacgg taatgtttat actcttgaat cggctgataa cggatgtaat   960
 961 atcgtaaaaa taaagaatga ctttacttta gaaaaagtct ttgcaaactt ccagccggcc  1020
1021 aagggaccgt atcattcaag tccgaccata ggcatggtag catccgaaac agagaatatt  1080
1081 atttatctgg tatcgaccga cggagctata tataaatata tattaggcga ttcagactct  1140
1141 ctcaaagcac ctttcattgc cgcagaatca ggagtttcaa ttactgctcc attgcagctg  1200
1201 aaccaacaaa gcggagaact ctatgtaact tataccgaag aacggaaaga cgaatctaaa  1260
1261 attgtcgttt acagcaaaga cggaaaagtt ctccacacag tagactgtgg tgagagcgtt  1320
1321 ccttcacaaa tattattcaa taactaa  1347
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1834031 1835377 2 Glimmer3 score 7.01 poor
Genemark probabilities .84   .13 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu