LOADING...
   NP_810227.1;NP_810227.1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_810227.1    CL5305C            JCSG 359105 PDB Deposition 14-JUL-31

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_810227.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides thetaiotaomicron vpi-5482
COMMENT 
DR UNIPROT; Q8A860_BACTN
DR SPTR;
DR GenBank; NP_810227
DR Pfam; PF00877; NLPC_P60;
DR PDB; 3PVQ; Identical; 02-FEB-11; DIPEPTIDYL-PEPTIDASE VI;
DR PDB; 4R0K; Identical; 20-AUG-14; DIPEPTIDYL-PEPTIDASE VI;
DR PDB; 3NPF; Identical; 28-JUL-10; PUTATIVE DIPEPTIDYL-PEPTIDASE VI;
DR PDB; 3H41; Highly similar; 05-MAY-09; NLP/P60 FAMILY PROTEIN;
DR KEGG; 3.4.-.-; Enzyme page
DR FFAS; 359105; Fold and function assignment.
DR TVPC; NP_810227.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_810227.1; Ortholog view popup.
DR TPM; NP_810227.1; Target PDB monitor.
DR FSS; NP_810227.1; Target function coverage.
PROPERTY Residues: 328 aa
Molecule Weight: 37411.67 Dalton
Isoelectric Point: 6.87
Extinction Coefficient: 61310
Gravy Index: -.36
Number of Met residues: 10
Percentage of Met residues: 3.05 %
Number of Cys residues: 4
Percentage of Cys residues: 1.22 %
SEQUENCE  amino acids 328 aa
>NP_810227.1  gi|29346724|ref|NP_810227.1| dipeptidyl-peptidase VI [Bacteroides thetaiotaomicron VPI-5482]
MKKNILFFYCLLVVAVVSLKAQEIRPMPADSAYGVVHISVCNMRDEGKFTSGMSTQALLG
MPVKVLQYTGWYEIQTPDDYTGWVHRMVITPMSKEKYDEWNRAEKIVVTSHYGFTYEKPD
DDSQTVSDVVAGNRLKWEGSKGHFYKVSYPDGRQAYISRHISQPESKWRASLKQDAESII
KTAYTMIGIPYLWAGTSSKGVDCSGLVRTVLFMHDIIIPRDASQQAYVGERIEIAPDFSN
VQRGDLVFFGRKATADRKEGISHVGIYLGNKRFIHALGDVHISSFDPEDECYDEFNTGRL
LFATRFLPYINKEKGMNTTDHNLYYLHH

CDS  cDNA 987 bp
   1 atgaagaaaa atatcctttt tttctattgc ttgctggtag tagcagtagt tagtctgaaa    60
  61 gctcaggaaa tacgccccat gcctgctgat tcagcttatg gggtagtaca catttctgtt   120
 121 tgtaatatgc gtgatgaagg taagtttact tccggaatga gcacgcaggc actgcttggg   180
 181 atgccggtca aggtattgca atacaccggc tggtacgaga ttcagactcc ggatgactat   240
 241 acgggatggg tgcatcggat ggtgattacg ccgatgtcga aagagaaata tgatgaatgg   300
 301 aaccgtgcag agaagattgt ggtgacttcc cactacggat ttacgtatga aaaaccggat   360
 361 gacgactcgc agaccgtatc ggatgttgtt gctggcaatc gcctgaagtg ggagggaagt   420
 421 aaagggcatt tttacaaggt gtcttatccg gatggccgcc aggcttatat ctccagacat   480
 481 atttcacaac cagagagtaa atggagagct tcgttgaaac aagatgctga aagtattatt   540
 541 aaaactgctt atacaatgat cggaattccc tatctgtggg cagggacttc ttcgaaagga   600
 601 gttgattgca gcgggctggt ccggaccgta ctctttatgc atgatattat catcccaaga   660
 661 gatgcgtcac aacaggctta tgtaggcgaa cgtattgaga tagcccctga tttctccaac   720
 721 gtgcaacgcg gagacctcgt cttcttcggt cgtaaagcta cagccgaccg taaagaaggc   780
 781 atctcacacg tcggcatcta cctgggtaat aaacgcttca tccatgcctt gggagacgta   840
 841 catatcagca gctttgatcc cgaagacgag tgctacgatg agttcaacac cggtcgtctg   900
 901 ctttttgcca ctcgcttcct gccctatata aataaggaga aaggtatgaa taccaccgac   960
 961 cataacctct attatctaca tcactaa   987
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1638918 1639904 -3 Glimmer3 score 7.05 poor
Genemark probabilities .86   .43 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu