LOADING...
   NP_810194.1;SP7807Z
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_810194.1    SP7807Z            JCSG 417751 PDB Deposition 13-SEP-17              PDB id: 4mru

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_810194.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides thetaiotaomicron vpi-5482
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4MRU; Identical; 02-OCT-13; SUSD HOMOLOG;
DR PDB; 4F53; Highly similar; 11-JUL-12; SUSD HOMOLOG;
DR PDB; 4PUC; Highly similar; 04-JUN-14; SUSD HOMOLOG;
DR PDB; 3CGH; Highly similar; 18-MAR-08; SUSD HOMOLOG;
DR PDB; 3GZS; Highly similar; 21-APR-09; UNCHARACTERIZED SUSD SUPERFAMILY PROTEIN;
DR PDB; 3SGH; Highly similar; 06-JUL-11; SUSD HOMOLOG;
DR PDB; 4F7A; Highly similar; 30-MAY-12; PUTATIVE UNCHARACTERIZED PROTEIN;
DR PDB; 3EHM; Highly similar; 12-MAY-09; SUSD HOMOLOG;
DR FFAS; 408873; Fold and function assignment.
DR TVPC; NP_810194.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_810194.1; Ortholog view popup.
DR TPM; NP_810194.1; Target PDB monitor.
DR FSS; NP_810194.1; Target function coverage.
PROPERTY Residues: 531 aa
Molecule Weight: 60119.34 Dalton
Isoelectric Point: 4.94
Extinction Coefficient: 109670
Gravy Index: -.51
Number of Met residues: 22
Percentage of Met residues: 4.14 %
Number of Cys residues: 7
Percentage of Cys residues: 1.32 %
SEQUENCE  amino acids 531 aa
>NP_810194.1  gi|29346691|ref|NP_810194.1| hypothetical protein BT1281 [Bacteroides thetaiotaomicron VPI-5482]
MKNLRYMLIAACSACLLLPLGSCMDTDMNRNKYEVDSEEIGRENYDLGSTIRGLQGLVIP
AQEHLYQFMEAMCGGSYAGYFGETRTGWLEKYSTYNPKTDWLKAPFTDVISETYPKYYAV
LQHEDAPVALALAKLLRVTIMQRVTDIYGPIPYSKVLVSGEGSESDGLNAAYDSQKDVYM
RMFQELEEADQALEDNMTEGNSGFEKLDDVYYGKLQQWRLFLHSLQLRMAMRLCYTDMAA
EAQSIAEKAVTAGVIEKNDDNALFHVAENRSALCFNDWKDYRVGADIICYMNGYADPRRD
KYFTKVKNNDQEGYYGMRIGINSPFSDDDMITSYSNRLMTASDPYVWMTASEVAFLRAEG
ALRKWNMGGEAKDFYETGVKLSFEEHGASGAEDYLNSIASPSGYTDPLGSYSTGSPANIT
VKWNEMGEQAFEENLERIITQKWIALFPNGIESWSEHRRTGYPKLLPVVVNKGRNVSTEA
GMRRLMYPNEEYTQNSFHLNNAINVLIKESSNNQGGDTGGTHVWWDRKANK

CDS  cDNA 1596 bp
   1 atgaaaaacc tgcgatatat gctgatagca gcatgttcag cctgcctgct tctacctttg    60
  61 ggaagttgca tggatacgga catgaaccgt aataaatacg aagtggacag cgaagaaatc   120
 121 ggccgtgaaa actacgacct cggctccact atcagaggcc tgcaaggctt agtaatacct   180
 181 gcacaagagc atctttacca attcatggaa gccatgtgtg gtggttctta tgcaggatat   240
 241 ttcggtgaaa cacgtaccgg atggctggag aaatactcta cctataatcc taaaaccgac   300
 301 tggttgaagg caccatttac agatgttata tcagaaacat atcctaaata ttatgcagtt   360
 361 ttacaacatg aagatgcccc tgtagccctt gcattagcca aactgctacg agtaactatc   420
 421 atgcaacgcg tgacggacat ttacggccct atcccctata gcaaagtgtt agtatccgga   480
 481 gaaggttctg aaagcgatgg actgaatgcg gcttacgatt cacagaaaga tgtctacatg   540
 541 cgtatgtttc aagaacttga agaagccgat caggcacttg aagacaacat gacagaaggc   600
 601 aatagcggat ttgaaaagct ggatgatgtc tactacggaa aactacaaca atggcgcctt   660
 661 tttctccatt cactacaact acgcatggct atgcgcctat gctacaccga tatggctgcc   720
 721 gaagcccaaa gcattgccga gaaagccgta acggcaggag tgatcgaaaa gaacgacgac   780
 781 aatgccttat tccatgtagc agaaaatcgc tcagcactct gcttcaacga ttggaaagac   840
 841 tatcgtgtag gagccgatat catctgttac atgaatggtt atgcagaccc acgtcgggat   900
 901 aaatatttta ccaaggtgaa gaataacgac caggaaggtt attacggcat gcgtatcggc   960
 961 ataaattcac cattttctga tgacgacatg ataacatcgt actccaatcg tttgatgacc  1020
1021 gccagcgatc cttatgtatg gatgactgcc tccgaagtag cattcctgcg agccgaagga  1080
1081 gcattacgca aatggaatat gggcggtgaa gccaaagatt tctacgaaac aggggttaag  1140
1141 ctttcttttg aagaacatgg agccagcgga gcggaagact acctgaattc aatagcctct  1200
1201 ccaagtggct atactgaccc gctaggttcg tatagcacag gtagccccgc caacattaca  1260
1261 gtaaaatgga atgaaatggg agaacaggca ttcgaagaga atttggaacg tatcattacc  1320
1321 caaaagtgga ttgcactttt ccccaacggc attgaatcat ggagtgaaca caggcgtacc  1380
1381 ggatatccca aattattgcc tgttgtcgtg aacaaaggcc gcaatgttag taccgaagcc  1440
1441 ggcatgcgcc gactcatgta tcccaacgaa gaatacaccc agaattcttt ccaccttaac  1500
1501 aatgccatta atgtattgat aaaggaaagt agtaataatc aggggggaga taccggtggt  1560
1561 acccatgtat ggtgggatcg taaagcaaac aagtaa  1596
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1593871 1595466 1 Glimmer3 score 7.04 poor
Genemark probabilities .87   .28 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu