LOADING...
   NP_809759.1;SP16701A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_809759.1    SP16701A            JCSG 417790 PDB Deposition 13-FEB-07              PDB id: 2m4l

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_809759.1
DESCRIPTIONNMR structure of lipocalin-like protein, an orphan
ORGANISMBacteroides thetaiotaomicron vpi-5482
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2M4L; Identical; 27-MAR-13; PROTEIN BT_0846;
DR FFAS; 409160; Fold and function assignment.
DR TVPC; NP_809759.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_809759.1; Ortholog view popup.
DR TPM; NP_809759.1; Target PDB monitor.
DR FSS; NP_809759.1; Target function coverage.
PROPERTY Residues: 119 aa
Molecule Weight: 13557.5 Dalton
Isoelectric Point: 4.59
Extinction Coefficient: 24410
Gravy Index: -.38
Number of Met residues: 2
Percentage of Met residues: 1.68 %
Number of Cys residues: 2
Percentage of Cys residues: 1.68 %
SEQUENCE  amino acids 119 aa
>NP_809759.1  gi|29346256|ref|NP_809759.1| hypothetical protein BT0846 [Bacteroides thetaiotaomicron VPI-5482]
MKNILFTLFAILILTSCSKDEEDWTELNSNNIIGYWSTGIEGTHKLLSFDEDGTGSFGIY
SNATPISFQMFDYKIEEGRIYIYDVYPDEKTPYYLDCKISGTTLKVETGSEAGTYKKQK

CDS  cDNA 360 bp
   1 atgaaaaaca ttttattcac actttttgct attctcatct taactagctg cagcaaagat    60
  61 gaagaagatt ggactgaact taacagcaat aacattatag gttattggtc gacaggaatc   120
 121 gaaggtactc acaaattatt aagtttcgat gaggatggta ctggctcttt tggaatttac   180
 181 agcaatgcta ctccaatttc ctttcaaatg ttcgattata aaatcgagga aggtagaatc   240
 241 tatatttatg atgtatatcc agatgaaaag actccatatt atttagattg taagatatca   300
 301 ggcacgactc ttaaagtcga aaccggaagt gaagctggaa cctataagaa gcaaaaataa   360
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1038548 1038907 -2 Glimmer3 score - -
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu