LOADING...
   NP_809341.1;GE2184A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_809341.1    GE2184A            JCSG 396691 PDB Deposition 14-NOV-26              PDB id: 4rvo, 4r1l, 4r1m, 4rvn

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNP_809341.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides thetaiotaomicron vpi-5482
COMMENT 
DR UNIPROT; Q8AAN6_BACTN
DR SPTR; Q8AAN6 (flat text); Q8AAN6 (good view)
DR GenBank; NP_809341
DR PDB; 4R1L; Identical; 27-AUG-14; PHENYLACETATE-COENZYME A LIGASE;
DR PDB; 4R1M; Identical; 27-AUG-14; PHENYLACETATE-COENZYME A LIGASE;
DR PDB; 4RVO; Identical; 31-DEC-14; PHENYLACETATE-COENZYME A LIGASE;
DR PDB; 4RVN; Identical; 21-JAN-15; PHENYLACETATE-COENZYME A LIGASE;
DR PDB; 2Y4O; Highly similar; 09-MAR-11; PHENYLACETATE-COENZYME A LIGASE;
DR PDB; 2Y4N; Highly similar; 01-MAR-11; PHENYLACETATE-COENZYME A LIGASE;
DR PDB; 2Y27; Highly similar; 04-MAY-11; PHENYLACETATE-COENZYME A LIGASE;
DR KEGG; 6.2.; Enzyme page
DR FFAS; 396691; Fold and function assignment.
DR TVPC; NP_809341.1; Homologs in PDB, JCSG and SG center.
DR OVP; NP_809341.1; Ortholog view popup.
DR TPM; NP_809341.1; Target PDB monitor.
DR FSS; NP_809341.1; Target function coverage.
PROPERTY Residues: 435 aa
Molecule Weight: 49377.07 Dalton
Isoelectric Point: 5.94
Extinction Coefficient: 35870
Gravy Index: -.4
Number of Met residues: 15
Percentage of Met residues: 3.45 %
Number of Cys residues: 6
Percentage of Cys residues: 1.38 %
SEQUENCE  amino acids 435 aa
>NP_809341.1  gi|29345838|ref|NP_809341.1| phenylacetate-coenzyme A ligase [Bacteroides thetaiotaomicron VPI-5482]
MSTQYWEEEIEIMSREKLQELQLQRLKKTINIAANSPYYKEVFSKNGITGDSIQSLDDIR
KIPFTTKSDMRANYPFGLVAGDMKRDGVRIHSSSGTTGNPTVIVHSQHDLDSWANLVARC
LYMVGIRKTDVFQNSSGYGMFTGGLGFQYGAERLGCLTVPAAAGNSKRQIKFISDFKTTA
LHAIPSYAIRLAEVFQEEGIDPRETTLKTLVIGAEPHTDEQRRKIERMLNVKAYNSFGMT
EMNGPGVAFECQEQNGMHFWEDCYLVEIIDPETGEPVPEGEIGELVLTTLDREMMPLIRY
RTRDLTRILPGKCPCGRTHLRIDRIKGRSDDMFIIKGVNIFPMQVEKILVQFPELGSNYL
ITLETVNNQDEMIVEVELSDLSTDNYIELEKIRRDIIRQLKDEILVTPKVKLVKKGSLPQ
SEGKAVRVKDLRDNK

CDS  cDNA 1308 bp
   1 atgagtacac aatactggga agaagaaatt gaaatcatga gtcgcgagaa gttgcaggaa    60
  61 ctgcaacttc agcgactcaa aaaaacgatt aacatagccg caaactcacc ttattacaaa   120
 121 gaggttttca gcaaaaacgg catcaccgga gatagtatcc agtcactgga cgacatccgc   180
 181 aaaattcctt tcaccactaa atcggacatg cgtgccaact atcccttcgg gctagtggcc   240
 241 ggcgacatga aaagagacgg tgtacgtatc cactcttcca gtggaactac aggaaaccct   300
 301 acagtcatcg tacattcaca acatgacctc gactcatggg caaatctggt agcccgttgc   360
 361 ctttacatgg tggggatccg caagacagat gtcttccaga acagctccgg atatggaatg   420
 421 tttacaggtg gattaggttt tcaatatggt gcagaacgcc ttggctgcct taccgtacct   480
 481 gccgcagccg gaaacagtaa acggcaaatt aaattcatca gtgactttaa gactaccgcc   540
 541 ttacacgcca tcccaagcta cgctatccgt cttgccgaag tatttcagga agaaggtatc   600
 601 gacccgagag aaacaaccct gaaaaccttg gtgatcggcg ccgaaccgca tactgacgaa   660
 661 cagcgccgta aaatagaacg gatgctcaat gtgaaagcat ataatagttt cggtatgacg   720
 721 gaaatgaacg gccccggtgt tgccttcgaa tgccaggagc agaacggaat gcacttctgg   780
 781 gaagattgct atctggtaga aatcatcgat cctgaaacag gagaacccgt tcccgaagga   840
 841 gaaatcggtg aattggtact cactacactt gatcgtgaaa tgatgccgct tatccgctac   900
 901 cgcacccgcg accttacccg tatactaccc ggaaaatgtc cgtgcggccg cacccatctc   960
 961 cgcatcgacc ggatcaaggg acgcagcgac gatatgttta tcatcaaggg agtcaacatc  1020
1021 ttccccatgc aagtcgaaaa gattctggtt cagttccccg aattaggcag caattatctg  1080
1081 attacgctgg agacagtcaa caatcaggat gagatgatcg tcgaagtgga attaagcgat  1140
1141 ctttctacag acaactatat cgaactggaa aagatccgca gagatattat ccgtcaatta  1200
1201 aaagatgaaa tactggttac cccgaaagta aaactagtaa agaaagggtc tctcccgcag  1260
1261 agcgagggaa aagccgtcag agtgaaggac ttaagagaca acaaataa  1308
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
514550 515857 -2 Glimmer3 score 8.54 poor
Genemark probabilities .95   .66 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu